1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. UB2E2 Protein, Human (sf9)

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with tag free.

Background

UB2E2, a pivotal player in the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UB2E2 showcases its versatility by catalyzing 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, indicating its involvement in diverse cellular processes. Additionally, UB2E2 displays a unique capability to catalyze the ISGylation of influenza A virus NS1 protein, further expanding its functional repertoire and highlighting its significance in antiviral responses. This multifaceted activity underscores UB2E2's crucial role in protein modification and degradation pathways within the cellular regulatory network.

Biological Activity

The ubiquitin conjugating activity of UB2E2 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipy-ubiquitin. Incubation of UB2E2 for 60 minutes at 37℃ in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UB2E2 excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UB2E2.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q96LR5 (S2-T201)

Gene ID

7325

Molecular Construction
N-term
UB2E2 (S2-T201)
Accession # Q96LR5
C-term
Protein Length

Full Length of Mature Protein

Synonyms
UBE2E2; Ubiquitin-conjugating enzyme E2 E2; E2 ubiquitin-conjugating enzyme E2; UbcH8; Ubiquitin carrier protein E2; Ubiquitin-protein ligase E2
AA Sequence

STEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UB2E2 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UB2E2 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UB2E2 Protein, Human (sf9)
Cat. No.:
HY-P701488
Quantity:
MCE Japan Authorized Agent: