UB2E2 Protein, Human (sf9)

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with tag free.

UB2E2, a pivotal player in the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UB2E2 showcases its versatility by catalyzing 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, indicating its involvement in diverse cellular processes. Additionally, UB2E2 displays a unique capability to catalyze the ISGylation of influenza A virus NS1 protein, further expanding its functional repertoire and highlighting its significance in antiviral responses. This multifaceted activity underscores UB2E2's crucial role in protein modification and degradation pathways within the cellular regulatory network.

The ubiquitin conjugating activity of UB2E2 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipy-ubiquitin. Incubation of UB2E2 for 60 minutes at 37℃ in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UB2E2 excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UB2E2.

Human

Sf9 insect cells

Tag Free

Q96LR5 (S2-T201)

7325

Full Length of Mature Protein

STEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.