1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. UB2Q2 Protein, Human (sf9)

The UB2Q2 protein is a component of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme, adept at accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to a variety of protein substrates. In vitro, UB2Q2 efficiently mediates “Lys-48”-linked polyubiquitination. UB2Q2 Protein, Human (sf9) is the recombinant human-derived UB2Q2 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UB2Q2 protein is a component of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme, adept at accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to a variety of protein substrates. In vitro, UB2Q2 efficiently mediates “Lys-48”-linked polyubiquitination. UB2Q2 Protein, Human (sf9) is the recombinant human-derived UB2Q2 protein, expressed by sf9 insect cells , with tag free.

Background

UB2Q2, a crucial participant in the ubiquitin-proteasome system, operates as an E2 ubiquitin-conjugating enzyme, demonstrating proficiency in accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various protein substrates. In in vitro settings, UB2Q2 showcases its catalytic activity by efficiently mediating 'Lys-48'-linked polyubiquitination reactions. As a key contributor to the ubiquitin machinery, UB2Q2 plays a pivotal role in the targeted degradation of specific proteins, thereby influencing cellular processes regulated by ubiquitin-dependent proteolysis.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q8WVN8 (S2-G375)

Gene ID

92912

Molecular Construction
N-term
UB2Q2 (S2-G375)
Accession # Q8WVN8
C-term
Protein Length

Partial

Synonyms
UBE2Q2; Ubiquitin-conjugating enzyme E2 Q2; E2 ubiquitin-conjugating enzyme Q2; Ubiquitin carrier protein Q2; Ubiquitin-protein ligase Q2
AA Sequence

SVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UB2Q2 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UB2Q2 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UB2Q2 Protein, Human (sf9)
Cat. No.:
HY-P701495
Quantity:
MCE Japan Authorized Agent: