UB2Q2 Protein, Human (sf9)
The UB2Q2 protein is a component of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme, adept at accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to a variety of protein substrates. In vitro, UB2Q2 efficiently mediates “Lys-48”-linked polyubiquitination. UB2Q2 Protein, Human (sf9) is the recombinant human-derived UB2Q2 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The UB2Q2 protein is a component of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme, adept at accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to a variety of protein substrates. In vitro, UB2Q2 efficiently mediates “Lys-48”-linked polyubiquitination. UB2Q2 Protein, Human (sf9) is the recombinant human-derived UB2Q2 protein, expressed by sf9 insect cells , with tag free.
Background
UB2Q2, a crucial participant in the ubiquitin-proteasome system, operates as an E2 ubiquitin-conjugating enzyme, demonstrating proficiency in accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various protein substrates. In in vitro settings, UB2Q2 showcases its catalytic activity by efficiently mediating 'Lys-48'-linked polyubiquitination reactions. As a key contributor to the ubiquitin machinery, UB2Q2 plays a pivotal role in the targeted degradation of specific proteins, thereby influencing cellular processes regulated by ubiquitin-dependent proteolysis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q8WVN8 (S2-G375)
-
Gene ID92912
-
Molecular Construction
-
N-term
-
UB2Q2 (S2-G375)
Accession # Q8WVN8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2Q2; Ubiquitin Conjugating Enzyme E2 Q2; Ubiquitin-Conjugating Enzyme E2 Q2; E2 Ubiquitin-Conjugating Enzyme Q2; Ubiquitin Carrier Protein Q2; Ubiquitin-Protein Ligase Q2; DKFZp762C143; Ubiquitin-Conjugating Enzyme E2Q Family Member 2; Ubiquitin Conjug
-
AA Sequence
SVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
