UbcH7/UBE2L3 Protein, Human (sf9, His, StrepⅡ)

UbcH7/UBE2L3 is a unique ubiquitin-conjugating E2 enzyme that cooperates with HECT-type and RBR family E3 ligases and lacks intrinsic E3-independent reactivity with lysine. It uniquely works with RBR family E3 enzymes such as PRKN, RNF31 and ARIH1, acting like a RING-HECT hybrid. UbcH7/UBE2L3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UbcH7/UBE2L3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

UbcH7/UBE2L3 is a unique ubiquitin-conjugating E2 enzyme that cooperates with HECT-type and RBR family E3 ligases and lacks intrinsic E3-independent reactivity with lysine. It uniquely works with RBR family E3 enzymes such as PRKN, RNF31 and ARIH1, acting like a RING-HECT hybrid. UbcH7/UBE2L3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UbcH7/UBE2L3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UbcH7/UBE2L3, a ubiquitin-conjugating enzyme E2, exhibits specificity in collaboration with HECT-type and RBR family E3 ubiquitin-protein ligases. Notably, its unique characteristic is the absence of intrinsic E3-independent reactivity with lysine, rendering it incompatible with most RING-containing E3 ubiquitin-protein ligases. However, it demonstrates activity with RBR family E3 enzymes such as PRKN, RNF31, and ARIH1, functioning akin to RING-HECT hybrids. Acting downstream of the E1 complex, UbcH7 catalyzes the covalent attachment of ubiquitin to target proteins and, in vitro, facilitates 'Lys-11'-linked polyubiquitination. Its involvement in the selective degradation of short-lived and aberrant proteins highlights its role in cellular quality control. Additionally, down-regulation during the S-phase suggests a contribution to cell cycle progression, while its impact on nuclear hormone receptors' transcriptional activity and potential role in myelopoiesis further underscore its multifaceted functions.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-StrepⅡ;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His-StrepⅡ
    • UbcH7 (A2-D154)
      Accession # P68036-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    UBE2L3; Ubiquitin Conjugating Enzyme E2 L3; UBCH7; Ubiquitin-Conjugating Enzyme E2 L3; E2 Ubiquitin-Conjugating Enzyme L3; Ubiquitin-Conjugating Enzyme E2-F1; Ubiquitin Carrier Protein L3; Ubiquitin-Protein Ligase L3; L-UBC; Ubiquitin-Conjugating Enzyme E

  • AA Sequence

    AASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00