UbcH7/UBE2L3 Protein, Human (sf9, His, StrepⅡ)
UbcH7/UBE2L3 is a unique ubiquitin-conjugating E2 enzyme that cooperates with HECT-type and RBR family E3 ligases and lacks intrinsic E3-independent reactivity with lysine. It uniquely works with RBR family E3 enzymes such as PRKN, RNF31 and ARIH1, acting like a RING-HECT hybrid. UbcH7/UBE2L3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UbcH7/UBE2L3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
UbcH7/UBE2L3 is a unique ubiquitin-conjugating E2 enzyme that cooperates with HECT-type and RBR family E3 ligases and lacks intrinsic E3-independent reactivity with lysine. It uniquely works with RBR family E3 enzymes such as PRKN, RNF31 and ARIH1, acting like a RING-HECT hybrid. UbcH7/UBE2L3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UbcH7/UBE2L3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
UbcH7/UBE2L3, a ubiquitin-conjugating enzyme E2, exhibits specificity in collaboration with HECT-type and RBR family E3 ubiquitin-protein ligases. Notably, its unique characteristic is the absence of intrinsic E3-independent reactivity with lysine, rendering it incompatible with most RING-containing E3 ubiquitin-protein ligases. However, it demonstrates activity with RBR family E3 enzymes such as PRKN, RNF31, and ARIH1, functioning akin to RING-HECT hybrids. Acting downstream of the E1 complex, UbcH7 catalyzes the covalent attachment of ubiquitin to target proteins and, in vitro, facilitates 'Lys-11'-linked polyubiquitination. Its involvement in the selective degradation of short-lived and aberrant proteins highlights its role in cellular quality control. Additionally, down-regulation during the S-phase suggests a contribution to cell cycle progression, while its impact on nuclear hormone receptors' transcriptional activity and potential role in myelopoiesis further underscore its multifaceted functions.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
P68036-1 (A2-D154)
-
Gene ID7332
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UbcH7 (A2-D154)
Accession # P68036-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
UBE2L3; Ubiquitin Conjugating Enzyme E2 L3; UBCH7; Ubiquitin-Conjugating Enzyme E2 L3; E2 Ubiquitin-Conjugating Enzyme L3; Ubiquitin-Conjugating Enzyme E2-F1; Ubiquitin Carrier Protein L3; Ubiquitin-Protein Ligase L3; L-UBC; Ubiquitin-Conjugating Enzyme E
-
AA Sequence
AASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)