UBE2J1 Protein, Human (Active)
Based on 1 Customer Validation
UBE2J1 Protein, Human (Active) is the recombinant human-derived UBE2J1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
UBE2J1 Protein, Human (Active) is the recombinant human-derived UBE2J1, expressed by E. coli , with tag Free labeled tag. ,
Background
UBE2J1 is a ubiquitin-conjugating enzyme that catalyzes the covalent attachment of ubiquitin to other proteins. It functions in the selective degradation of misfolded membrane proteins via the endoplasmic reticulum-associated degradation (ERAD) pathway and is essential for cellular recovery from ER stress. Additionally, UBE2J1 plays a role in the MAPKAPK2-dependent translational control of TNF-alpha synthesis. It also acts as a platform for perinuclear positioning of the endosomal system by mediating ubiquitination of SQSTM1 through interaction with the E3 ubiquitin-protein ligase RNF26. In male fecundity, UBE2J1 interacts with the E3 ubiquitin-protein ligase RNF133 to exert its function.
Verified Bioactivity
Active
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y385 (M1-T282)
-
Gene ID51465
-
Protein Length
Cytoplasmic Domain
-
Synonyms
UBE2J1; Ubiquitin Conjugating Enzyme E2 J1; NCUBE1; HSPC153; CGI-76; UBC6; Ubiquitin-Conjugating Enzyme E2, J1 (UBC6 Homolog,Yeast); Yeast Ubiquitin-Conjugating Enzyme UBC6 Homolog E; Non-Canonical Ubiquitin-Conjugating Enzyme 1; Ubiquitin-Conjugating Enz
-
AA Sequence
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHT
-
Predicted Molecular Mass
31.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)