Copy Link Print Information

UBE2N/Ubc13 Protein, Human (sf9, His, StrepII)

Customer Review

Based on 1 Customer Validation

The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2N/Ubc13 Protein, Human (sf9, His, Strep) is the recombinant Rhesus Macaque, cynomolgus-derived UBE2N/Ubc13 protein, expressed by Sf9 insect cells , with N-8*His, N-Strep labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • UBE2N/Ubc13 Protein, Human (sf9, His, StrepII) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2N/Ubc13 Protein, Human (sf9, His, Strep) is the recombinant Rhesus Macaque, cynomolgus-derived UBE2N/Ubc13 protein, expressed by Sf9 insect cells , with N-8*His, N-Strep labeled tag.

Background

UBE2F protein plays a crucial role in the ubiquitin-like protein NEDD8 conjugation pathway, accepting NEDD8 from the UBA3-NAE1 E1 complex and catalyzing its covalent attachment to various target proteins. Its distinctive interaction with the E3 ubiquitin ligase RBX2, rather than RBX1, implies that the RBX2-UBE2F complex is specialized in neddylating specific target proteins, notably CUL5. This specific interaction and neddylating activity highlight UBE2F's involvement in the regulation of cellular processes related to the targeted ubiquitination of key substrates.

Verified Bioactivity

Incubation of UBE2N for 60 minutes at 37˚C in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UBE2N excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UBE2N.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-StrepⅡ;N-8*His
  • Accession

    P61088 (A2-I152)

  • Gene ID
    7334  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His-StrepⅡ
    • UBE2N (A2-I152)
      Accession # Q969M7
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2N; Ubiquitin Conjugating Enzyme E2 N; UbcH-Ben; UBC13; Ubiquitin-Conjugating Enzyme E2N (Homologous To Yeast UBC13); Ubiquitin-Conjugating Enzyme E2N (UBC13 Homolog, Yeast); Ubiquitin-Conjugating Enzyme E2 N; E2 Ubiquitin-Conjugating Enzyme N; Ubiquit

  • AA Sequence

    AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

  • Predicted Molecular Mass

    19 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl (pH7.5), 200 mM NaCl, 1 mM DTT, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • UBE2N/Ubc13 Protein, Human (sf9, His, StrepII) Product Image
    1/16
  • UBE2N/Ubc13 Protein, Human (sf9, His, StrepII) Product Image