UEVLD Protein, Human (sf9, His, StrepⅡ)
UEVLD proteins are considered potential negative regulators of polyubiquitination, possibly controlling the ubiquitin-proteasome system. Its ability to form homodimers suggests that it has self-interacting properties, which may contribute to its role in regulating polyubiquitin chains. UEVLD Protein, Human (sf9, His, Strep) is the recombinant human-derived UEVLD protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UEVLD proteins are considered potential negative regulators of polyubiquitination, possibly controlling the ubiquitin-proteasome system. Its ability to form homodimers suggests that it has self-interacting properties, which may contribute to its role in regulating polyubiquitin chains. UEVLD Protein, Human (sf9, His, Strep) is the recombinant human-derived UEVLD protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
UEVLD protein is suggested to function as a potential negative regulator of polyubiquitination, possibly exerting regulatory control over the ubiquitin-proteasome system. The protein is known to form homodimers, indicating a self-interacting nature that may contribute to its functional role in modulating polyubiquitin chains. The specifics of its regulatory mechanism and the range of proteins or processes it may influence warrant further investigation, but its homodimeric nature suggests a potential involvement in the intricate network of cellular ubiquitination pathways.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q8IX04 (E2-L471)
-
Gene ID55293
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UEVLD (E2-L471)
Accession # Q8IX04 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UEVLD; UEV And Lactate/Malate Dehydrogenase Domains; UEV3; Attp; EV And Lactate/Malate Dehydrogenase Domain-Containing Protein; Ubiquitin-Conjugating Enzyme E2 Variant 3; UEV-3; Signaling Molecule ATTP
-
AA Sequence
EFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
