1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. UEVLD Protein, Human (sf9, His, StrepⅡ)

UEVLD proteins are considered potential negative regulators of polyubiquitination, possibly controlling the ubiquitin-proteasome system. Its ability to form homodimers suggests that it has self-interacting properties, which may contribute to its role in regulating polyubiquitin chains. UEVLD Protein, Human (sf9, His, Strep) is the recombinant human-derived UEVLD protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UEVLD proteins are considered potential negative regulators of polyubiquitination, possibly controlling the ubiquitin-proteasome system. Its ability to form homodimers suggests that it has self-interacting properties, which may contribute to its role in regulating polyubiquitin chains. UEVLD Protein, Human (sf9, His, Strep) is the recombinant human-derived UEVLD protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UEVLD protein is suggested to function as a potential negative regulator of polyubiquitination, possibly exerting regulatory control over the ubiquitin-proteasome system. The protein is known to form homodimers, indicating a self-interacting nature that may contribute to its functional role in modulating polyubiquitin chains. The specifics of its regulatory mechanism and the range of proteins or processes it may influence warrant further investigation, but its homodimeric nature suggests a potential involvement in the intricate network of cellular ubiquitination pathways.

Species

Human

Source

Sf9 insect cells

Tag

N-StrepⅡ;N-8*His

Accession

Q8IX04 (E2-L471)

Gene ID

55293

Molecular Construction
N-term
8*His-StrepⅡ
UEVLD (E2-L471)
Accession # Q8IX04
C-term
Protein Length

Partial

Synonyms
UEVLD; Ubiquitin-conjugating enzyme E2 variant 3; UEV-3; EV and lactate/malate dehydrogenase domain-containing protein
AA Sequence

EFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UEVLD Protein, Human (sf9, His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UEVLD Protein, Human (sf9, His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UEVLD Protein, Human (sf9, His, StrepⅡ)
Cat. No.:
HY-P701499
Quantity:
MCE Japan Authorized Agent: