uPAR Protein, Human (Biotinylated, HEK293, His-Avi)

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived uPAR protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

uPAR Protein functions as a receptor for urokinase plasminogen activator, actively participating in the localization and facilitation of plasmin formation. Additionally, it serves as a mediator of the proteolysis-independent signal transduction activation effects induced by U-PA. Subject to negative-feedback regulation by U-PA, uPAR Protein undergoes cleavage into an inactive form. Typically existing as a monomer, it interacts with various proteins, including MRC2, SRPX2 (via the UPAR/Ly6 domains), and FAP (seprase), with the latter interaction occurring at the cell surface of invadopodia membrane. Moreover, uPAR Protein engages in an interaction with SORL1, specifically through the N-terminal ectodomain, and this interaction has been associated with a decrease in PLAUR internalization. Notably, the formation of a ternary complex composed of PLAUR, PLAU (urokinase-type plasminogen activator), and SERPINE1 also involves an interaction with SORL1.

Immobilized Human PLAU, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human uPAR, His Tag with the EC₅₀ of 25.1ng/ml determined by ELISA.

Human

HEK293

C-Avi;C-8*His

Q03405-1 (L23-G305)

5329  [NCBI]

Full Length of Isoform-1 Mature Protein

Biotin

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG

Approximately 50-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.