Uridylate Kinase Protein, Human (His)
Uridylate Kinase Protein, Human (His) is the recombinant human-derived Uridylate Kinase, expressed by E. coli , with His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Uridylate Kinase Protein, Human (His) is the recombinant human-derived Uridylate Kinase, expressed by E. coli , with His labeled tag. ,
Background
Uridylate Kinase is an enzyme that catalyzes the reversible phosphorylation of UMP to UDP, with ATP serving as the most efficient phosphate donor.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His
-
Accession
P0A7E9 (M1-E241)
-
Gene ID944989
-
Protein Length
Full Length
-
Synonyms
Uridylate kinase; EC:2.7.4.22; Uridine monophosphate kinase; UK; UMP kinase; UMPK; smbA; pyrH; b0171; JW0166
-
AA Sequence
MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
-
Predicted Molecular Mass
27 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
