1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Deubiquitinase
  4. Ubiquitin-Specific Protease
  5. Ubiquitin specific peptidase 50 (USP50)
  6. USP50 Protein, Human (sf9, GST)

USP50 protein, also known as ubiquitin-specific protease 50, is a protein without peptidase activity. Peptidase activity generally refers to the ability of an enzyme to cleave peptide bonds in proteins. USP50 Protein, Human (sf9, GST) is the recombinant human-derived USP50 protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

USP50 protein, also known as ubiquitin-specific protease 50, is a protein without peptidase activity. Peptidase activity generally refers to the ability of an enzyme to cleave peptide bonds in proteins. USP50 Protein, Human (sf9, GST) is the recombinant human-derived USP50 protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

USP50 protein, also known as ubiquitin-specific protease 50, is a protein that does not possess peptidase activity. Peptidase activity typically refers to the ability of an enzyme to cleave peptide bonds in proteins. However, USP50 protein lacks this particular enzymatic activity. While the function of USP50 protein is still not fully understood, its lack of peptidase activity suggests that it may have other roles or functions within the cell that do not involve direct peptide bond cleavage. Further research is needed to uncover the exact role and significance of USP50 protein in cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

Q70EL3 (T2-A339)

Gene ID

373509

Molecular Construction
N-term
GST
USP50 (T2-A339)
Accession # Q70EL3
C-term
Protein Length

Partial

Synonyms
USP50; Inactive ubiquitin carboxyl-terminal hydrolase 50; Inactive ubiquitin-specific peptidase 50
AA Sequence

TSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVEYFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

USP50 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
USP50 Protein, Human (sf9, GST)
Cat. No.:
HY-P701423
Quantity:
MCE Japan Authorized Agent: