Copy Link Print Information

vacA Protein, Helicobacter pylori (His)

Customer Review

Based on 1 Customer Validation

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for vacA Protein, Helicobacter pylori (His)
  • Experimental Validation Results for vacA Protein, Helicobacter pylori (His)
  • vacA Protein, Helicobacter pylori (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

Background

VacA protein takes center stage with its distinctive ability to induce vacuolation in eukaryotic cells, showcasing its potent impact on cellular morphology. This process, characterized by the formation of vacuoles within the cells, reflects VacA's role as a key modulator of cellular architecture. Beyond its influence on cell morphology, VacA is implicated in causing ulceration and gastric lesions, underscoring its significant role in the pathogenesis of gastric disorders. The dual effects of vacuolation induction and the promotion of gastric lesions position VacA as a critical virulence factor, shedding light on its role in the complex interplay between bacterial pathogens and host cells in the context of gastric pathology.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is <150 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is 135.7 ng/mL.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-6*His
  • Accession

    P55981 (T37-N245)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • 6*His
    • vacA (T37-N245)
      Accession # P55981
    • C-term
  • Protein Length

    Partial

  • Synonyms

    vacA; HP_0887; Vacuolating cytotoxin autotransporter Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator

  • AA Sequence

    TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

  • Predicted Molecular Mass

    22.6 kDa

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is 135.7 ng/mL.

  • vacA Protein, Helicobacter pylori (His) Product Image
    1/16
  • Experimental Validation Results for vacA Protein, Helicobacter pylori (His)
  • Experimental Validation Results for vacA Protein, Helicobacter pylori (His)
  • vacA Protein, Helicobacter pylori (His) Product Image