vacA Protein, Helicobacter pylori (His)

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

VacA protein takes center stage with its distinctive ability to induce vacuolation in eukaryotic cells, showcasing its potent impact on cellular morphology. This process, characterized by the formation of vacuoles within the cells, reflects VacA's role as a key modulator of cellular architecture. Beyond its influence on cell morphology, VacA is implicated in causing ulceration and gastric lesions, underscoring its significant role in the pathogenesis of gastric disorders. The dual effects of vacuolation induction and the promotion of gastric lesions position VacA as a critical virulence factor, shedding light on its role in the complex interplay between bacterial pathogens and host cells in the context of gastric pathology.

Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED₅₀ for this effect is <150 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED₅₀ for this effect is 135.7 ng/mL.

Others

E. coli

N-6*His

P55981 (T37-N245)

/

Partial

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.