VEGF121 Protein, Human (HEK293, His-Avi)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (HEK293, His-Avi) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF121 Protein, Human (HEK293, His-Avi) is 121 a.a., with molecular weight of ~18 kDa & 22-25 kDa, respectively.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (HEK293, His-Avi) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF121 Protein, Human (HEK293, His-Avi) is 121 a.a., with molecular weight of ~18 kDa & 22-25 kDa, respectively.

Background

VEGF121 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a growth factor active in angiogenesis, vasculogenesis, and endothelial cell growth. VEGF-A induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis, and induces permeabilization of blood vessels. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, as well as heparan sulfate and heparin. It also binds to the NRP1/neuropilin-1 receptor. When VEGF-A binds to NRP1, it initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VEGF121 (A27-R147)
      Accession # P15692-9
    • 8*His-Avi
    • C-term
  • Protein Length

    Full Length of Isoform-9

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 18 kDa & 22-25 kDa under reduced (R) conditions, 30 kDa & 32-40 kDa under non reducing (N) conditions, based on SDS-PAGE.

  • Structure/Form

    Homodimer

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00