VKOR1 Protein, Human (HEK293, GFP, His)
As the catalytic subunit of the VKOR complex, the VKOR1 protein is crucial in vitamin K metabolism and is essential for the reduction of inactive vitamin K 2,3-epoxide to the active form. This process is critical for γ-carboxylation of proteins and is particularly important for blood coagulation and the synthesis of coagulation factors. VKOR1 Protein, Human (HEK293, GFP, His) is the recombinant human-derived VKOR1 protein, expressed by HEK293 , with C-10*His, GFP labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
As the catalytic subunit of the VKOR complex, the VKOR1 protein is crucial in vitamin K metabolism and is essential for the reduction of inactive vitamin K 2,3-epoxide to the active form. This process is critical for γ-carboxylation of proteins and is particularly important for blood coagulation and the synthesis of coagulation factors. VKOR1 Protein, Human (HEK293, GFP, His) is the recombinant human-derived VKOR1 protein, expressed by HEK293 , with C-10*His, GFP labeled tag.
Background
VKOR1 protein is a key player in vitamin K metabolism, serving as the catalytic subunit of the vitamin K epoxide reductase (VKOR) complex. This complex plays a crucial role in the reduction of inactive vitamin K 2,3-epoxide to its active form, essential for the gamma-carboxylation of various proteins. Among its vital functions, VKOR1 is particularly significant for blood coagulation, contributing to the synthesis of clotting factors. Furthermore, vitamin K, facilitated by VKOR1, is indispensable for normal bone development, highlighting the protein's broader impact on physiological processes beyond hemostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His;GFP
-
Accession
Q9BQB6 (M1-H163)
-
Gene ID79001
-
Protein Length
Full Length
-
Synonyms
VKORC1; Vitamin K Epoxide Reductase Complex Subunit 1; VKCFD2; Vitamin K Dependent Clotting Factors Deficiency 2; Vitamin K1 2,3-Epoxide Reductase Subunit 1; Vitamin K Oxidoreductase; VKOR; Vitamin K1 Epoxide Reductase (Warfarin-Sensitive); Vitamin-K-Epox
-
AA Sequence
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
