1. Recombinant Proteins
  2. Others
  3. VKOR1 Protein, Human (HEK293, GFP, His)

As the catalytic subunit of the VKOR complex, the VKOR1 protein is crucial in vitamin K metabolism and is essential for the reduction of inactive vitamin K 2,3-epoxide to the active form. This process is critical for γ-carboxylation of proteins and is particularly important for blood coagulation and the synthesis of coagulation factors. VKOR1 Protein, Human (HEK293, GFP, His) is the recombinant human-derived VKOR1 protein, expressed by HEK293 , with C-10*His, GFP labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As the catalytic subunit of the VKOR complex, the VKOR1 protein is crucial in vitamin K metabolism and is essential for the reduction of inactive vitamin K 2,3-epoxide to the active form. This process is critical for γ-carboxylation of proteins and is particularly important for blood coagulation and the synthesis of coagulation factors. VKOR1 Protein, Human (HEK293, GFP, His) is the recombinant human-derived VKOR1 protein, expressed by HEK293 , with C-10*His, GFP labeled tag.

Background

VKOR1 protein is a key player in vitamin K metabolism, serving as the catalytic subunit of the vitamin K epoxide reductase (VKOR) complex. This complex plays a crucial role in the reduction of inactive vitamin K 2,3-epoxide to its active form, essential for the gamma-carboxylation of various proteins. Among its vital functions, VKOR1 is particularly significant for blood coagulation, contributing to the synthesis of clotting factors. Furthermore, vitamin K, facilitated by VKOR1, is indispensable for normal bone development, highlighting the protein's broader impact on physiological processes beyond hemostasis.

Species

Human

Source

HEK293

Tag

C-10*His;GFP

Accession

Q9BQB6 (M1-H163)

Gene ID

79001

Protein Length

Full Length

Synonyms
VKORC1; Vitamin K epoxide reductase complex subunit 1; Vitamin K1 2; 3-epoxide reductase subunit 1
AA Sequence

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

VKOR1 Protein, Human (HEK293, GFP, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

VKOR1 Protein, Human (HEK293, GFP, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VKOR1 Protein, Human (HEK293, GFP, His)
Cat. No.:
HY-P701835
Quantity:
MCE Japan Authorized Agent: