VKOR1 Protein, Human (HEK293, GFP, His)

As the catalytic subunit of the VKOR complex, the VKOR1 protein is crucial in vitamin K metabolism and is essential for the reduction of inactive vitamin K 2,3-epoxide to the active form. This process is critical for γ-carboxylation of proteins and is particularly important for blood coagulation and the synthesis of coagulation factors. VKOR1 Protein, Human (HEK293, GFP, His) is the recombinant human-derived VKOR1 protein, expressed by HEK293 , with C-10*His, GFP labeled tag.

VKOR1 protein is a key player in vitamin K metabolism, serving as the catalytic subunit of the vitamin K epoxide reductase (VKOR) complex. This complex plays a crucial role in the reduction of inactive vitamin K 2,3-epoxide to its active form, essential for the gamma-carboxylation of various proteins. Among its vital functions, VKOR1 is particularly significant for blood coagulation, contributing to the synthesis of clotting factors. Furthermore, vitamin K, facilitated by VKOR1, is indispensable for normal bone development, highlighting the protein's broader impact on physiological processes beyond hemostasis.

Human

HEK293

C-10*His;GFP

Q9BQB6 (M1-H163)

79001

Full Length

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.