VMO1 Protein, Human (HEK293, Fc)
Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, Fc) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, Fc) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. Determination of the crystal structure of VMO1 revealed that VMO1 may interact with glycosylated proteins.VMO1 is a secreted protein and exerts important functions in inner ear and tear film[1].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q7Z5L0-1 (Q25-S202)
-
Molecular Construction
-
N-term
-
VMO1 (Q25-S202)
Accession # Q7Z5L0-1 -
mFc
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
VMO1; Vitelline Membrane Outer Layer 1 Homolog; Vitelline Membrane Outer Layer Protein 1 Homolog; Vitelline Membrane Outer Layer 1 Homolog (Chicken); ERGA6350; PRO21055
-
AA Sequence
QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS
-
Predicted Molecular Mass
45.4 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
