VMO1 Protein, Human (HEK293, Fc)

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, Fc) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-mFc labeled tag.

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. Determination of the crystal structure of VMO1 revealed that VMO1 may interact with glycosylated proteins.VMO1 is a secreted protein and exerts important functions in inner ear and tear film^[1].

Human

HEK293

C-mFc

Q7Z5L0-1 (Q25-S202)

284013  [NCBI]

Full Length of Isoform-1 Mature Protein

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Wang Z, et al. Vitelline membrane outer layer 1 homolog interacts with lysozyme C and promotes the stabilization of tear film. Invest Ophthalmol Vis Sci. 2014 Sep 25;55(10):6722-7.  [Content Brief]