VP40 Protein, Zaire ebolavirus (H269L)
The VP40 protein is critical in viral assembly and interacts with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TSG101). It promotes efficient budding and binds to the host E3 ubiquitin ligase SMURF2. VP40 Protein, Zaire ebolavirus (H269L) is the recombinant Virus-derived VP40 protein, expressed by E. coli , with tag free.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The VP40 protein is critical in viral assembly and interacts with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TSG101). It promotes efficient budding and binds to the host E3 ubiquitin ligase SMURF2. VP40 Protein, Zaire ebolavirus (H269L) is the recombinant Virus-derived VP40 protein, expressed by E. coli , with tag free.
Background
The VP40 protein plays a vital role in virus particle assembly and budding, orchestrating complex interactions with both viral and host components. It engages in a multifaceted network by interacting with the viral ribonucleocapsid and various host proteins of the ESCRT system, including VPS4, PDCD6IP/ALIX, NEDD4, or TGS101, crucial for efficient budding. The association with host E3 ubiquitin ligase SMURF2 further facilitates virus budding. Additionally, VP40's involvement extends to immune cell dysfunction, as it can be packaged into exosomes, reducing the viability of recipient cells through RNAi suppression and exosome-bystander apoptosis. Existing in different oligomeric forms, such as homodimers, homohexamers critical for budding, and homooctamers involved in genome replication and RNA binding, VP40 exhibits dynamic structural transitions. Notably, its interaction with various host factors, including TSG101, NEDD4, PDCD6IP/ALIX, SMURF2, and ITCH, highlights the complexity of VP40-mediated processes, shedding light on its central role in the intricate machinery governing virus assembly and egress.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag Tag Free
-
Accession
Q05128 (N31-K326, H269L)
-
Gene ID911825
-
Molecular Construction
-
N-term
-
VP40 (N31-K326, H269L)
Accession # Q05128 -
C-term
-
-
Protein Length
Partial
-
Synonyms
VP40; Matrix protein VP40; Ebola VP40; eVP40; Membrane-associated protein VP40
-
AA Sequence
NSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)