1. Recombinant Proteins
  2. Viral Proteins
  3. VP40 Protein, Zaire ebolavirus (H269L)

The VP40 protein is critical in viral assembly and interacts with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TSG101). It promotes efficient budding and binds to the host E3 ubiquitin ligase SMURF2. VP40 Protein, Zaire ebolavirus (H269L) is the recombinant Virus-derived VP40 protein, expressed by E. coli , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The VP40 protein is critical in viral assembly and interacts with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TSG101). It promotes efficient budding and binds to the host E3 ubiquitin ligase SMURF2. VP40 Protein, Zaire ebolavirus (H269L) is the recombinant Virus-derived VP40 protein, expressed by E. coli , with tag free.

Background

The VP40 protein plays a vital role in virus particle assembly and budding, orchestrating complex interactions with both viral and host components. It engages in a multifaceted network by interacting with the viral ribonucleocapsid and various host proteins of the ESCRT system, including VPS4, PDCD6IP/ALIX, NEDD4, or TGS101, crucial for efficient budding. The association with host E3 ubiquitin ligase SMURF2 further facilitates virus budding. Additionally, VP40's involvement extends to immune cell dysfunction, as it can be packaged into exosomes, reducing the viability of recipient cells through RNAi suppression and exosome-bystander apoptosis. Existing in different oligomeric forms, such as homodimers, homohexamers critical for budding, and homooctamers involved in genome replication and RNA binding, VP40 exhibits dynamic structural transitions. Notably, its interaction with various host factors, including TSG101, NEDD4, PDCD6IP/ALIX, SMURF2, and ITCH, highlights the complexity of VP40-mediated processes, shedding light on its central role in the intricate machinery governing virus assembly and egress.

Species

Virus

Source

E. coli

Tag

Tag Free

Accession

Q05128 (N31-K326, H269L)

Gene ID

911825

Molecular Construction
N-term
VP40 (N31-K326, H269L)
Accession # Q05128
C-term
Protein Length

Partial

Synonyms
VP40; Matrix protein VP40; Ebola VP40; eVP40; Membrane-associated protein VP40
AA Sequence

NSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

VP40 Protein, Zaire ebolavirus (H269L) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

VP40 Protein, Zaire ebolavirus (H269L)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
VP40 Protein, Zaire ebolavirus (H269L)
Cat. No.:
HY-P702060
수량:
MCE Japan Authorized Agent: