VP40 Protein, Zaire ebolavirus (H269L)

The VP40 protein is critical in viral assembly and interacts with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TSG101). It promotes efficient budding and binds to the host E3 ubiquitin ligase SMURF2. VP40 Protein, Zaire ebolavirus (H269L) is the recombinant Virus-derived VP40 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The VP40 protein is critical in viral assembly and interacts with viral ribonucleocapsid and host ESCRT proteins (VPS4, PDCD6IP/ALIX, NEDD4, TSG101). It promotes efficient budding and binds to the host E3 ubiquitin ligase SMURF2. VP40 Protein, Zaire ebolavirus (H269L) is the recombinant Virus-derived VP40 protein, expressed by E. coli , with tag free.

Background

The VP40 protein plays a vital role in virus particle assembly and budding, orchestrating complex interactions with both viral and host components. It engages in a multifaceted network by interacting with the viral ribonucleocapsid and various host proteins of the ESCRT system, including VPS4, PDCD6IP/ALIX, NEDD4, or TGS101, crucial for efficient budding. The association with host E3 ubiquitin ligase SMURF2 further facilitates virus budding. Additionally, VP40's involvement extends to immune cell dysfunction, as it can be packaged into exosomes, reducing the viability of recipient cells through RNAi suppression and exosome-bystander apoptosis. Existing in different oligomeric forms, such as homodimers, homohexamers critical for budding, and homooctamers involved in genome replication and RNA binding, VP40 exhibits dynamic structural transitions. Notably, its interaction with various host factors, including TSG101, NEDD4, PDCD6IP/ALIX, SMURF2, and ITCH, highlights the complexity of VP40-mediated processes, shedding light on its central role in the intricate machinery governing virus assembly and egress.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VP40 (N31-K326, H269L)
      Accession # Q05128
    • C-term
  • Protein Length

    Partial

  • Synonyms

    VP40; Matrix protein VP40; Ebola VP40; eVP40; Membrane-associated protein VP40

  • AA Sequence

    NSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00