VSIG1 Protein, Mouse (HEK293, His)

VSIG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG1 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VSIG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG1 protein, expressed by HEK293, with C-His labeled tag.

Background

VSIG1 is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testicles, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 mediates activation of Wnt/β-catenin signaling pathway as a new target for epithelial-mesenchymal transformation in gastric cancer. VSIG1 has a tumor suppressor function, reducing the proliferation and migration ability of tumor cells[1][2][3][4][5].

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VSIG1 (V23-E234)
      Accession # Q9D2J4
    • 8*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VSIG1; V-Set And Immunoglobulin Domain Containing 1; GPA34; Glycoprotein A34; V-Set And Immunoglobulin Domain-Containing Protein 1; Cell Surface A33 Antigen; MGC44287; 1700062D20Rik; DJ889N15.1

  • AA Sequence

    VQVTIPDTFVNVTVGSNVTLLCLYTTTEKSLEKLSIQWSFFHNKEMEEPISIYYSEGGQASAIGQFKDRIIGATNPGNASITILHMQPADSGIYICDVNNPPHFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAFGTPSPLYYWYNIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEIDLTSSHPE

  • Predicted Molecular Mass

    24.2 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00