VSIG1 Protein, Mouse (HEK293, His)
VSIG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG1 protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
VSIG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG1 protein, expressed by HEK293, with C-His labeled tag.
Background
VSIG1 is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testicles, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 mediates activation of Wnt/β-catenin signaling pathway as a new target for epithelial-mesenchymal transformation in gastric cancer. VSIG1 has a tumor suppressor function, reducing the proliferation and migration ability of tumor cells[1][2][3][4][5].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9D2J4 (V23-E234)
-
Molecular Construction
-
N-term
-
VSIG1 (V23-E234)
Accession # Q9D2J4 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VSIG1; V-Set And Immunoglobulin Domain Containing 1; GPA34; Glycoprotein A34; V-Set And Immunoglobulin Domain-Containing Protein 1; Cell Surface A33 Antigen; MGC44287; 1700062D20Rik; DJ889N15.1
-
AA Sequence
VQVTIPDTFVNVTVGSNVTLLCLYTTTEKSLEKLSIQWSFFHNKEMEEPISIYYSEGGQASAIGQFKDRIIGATNPGNASITILHMQPADSGIYICDVNNPPHFVGKNQGLLDVTVLVKPSKPFCTIQGRPEAGHPISLSCLSAFGTPSPLYYWYNIEGNTIVPVKESFNTATGVLVIGNLTNFEQGYYQCTAINSLGNSSCEIDLTSSHPE
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
