WDR5 Protein, Human
Based on 1 Customer Validation
WDR5 Protein, Human is the recombinant human-derived WDR5, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
WDR5 Protein, Human is the recombinant human-derived WDR5, expressed by E. coli , with tag Free labeled tag. ,
Background
WDR5 is a protein involved in histone modification, contributing to the positioning of the N-terminus of histone H3 for efficient trimethylation at Lys-4 (PubMed:16829960). As part of the MLL1/MLL complex, it participates in methylation and dimethylation of histone H3 at Lys-4 (PubMed:19556245), with H3 Lys-4 methylation serving as a specific tag for epigenetic transcriptional activation (PubMed:18840606). Within the NSL complex, it may be involved in the acetylation of nucleosomal histone H4 at multiple lysine residues (PubMed:19103755, PubMed:20018852). By similarity, it may regulate osteoblast differentiation. Additionally, in association with RBBP5 and ASH2L, WDR5 stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A, and SETD1B (PubMed:21220120, PubMed:22266653).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P61964 (S22-C334)
-
Gene ID11091
-
Protein Length
Partial
-
Synonyms
WDR5; WD Repeat Domain 5; CFAP89; BIG-3; SWD3; Cilia And Flagella Associated Protein 89; WD Repeat-Containing Protein 5; BMP2-Induced 3-Kb Gene Protein; BMP-2-Induced Gene 3 Kb; BIG3; SWD3, Set1c WD40 Repeat Protein, Homolog (S. Cerevisiae); SWD3, Set1c W
-
AA Sequence
SATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)