WDR5 Protein, Human

WDR5 Protein, Human is the recombinant human-derived WDR5, expressed by E. coli , with tag Free labeled tag. ,

WDR5 is a protein involved in histone modification, contributing to the positioning of the N-terminus of histone H3 for efficient trimethylation at Lys-4 (PubMed:16829960). As part of the MLL1/MLL complex, it participates in methylation and dimethylation of histone H3 at Lys-4 (PubMed:19556245), with H3 Lys-4 methylation serving as a specific tag for epigenetic transcriptional activation (PubMed:18840606). Within the NSL complex, it may be involved in the acetylation of nucleosomal histone H4 at multiple lysine residues (PubMed:19103755, PubMed:20018852). By similarity, it may regulate osteoblast differentiation. Additionally, in association with RBBP5 and ASH2L, WDR5 stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A, and SETD1B (PubMed:21220120, PubMed:22266653).

Human

E. coli

Tag Free

P61964 (S22-C334)

11091

Partial

SATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/hepg2-cell.html  [Content Brief]