YBX1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

YBX1 Protein, Human (His) is the recombinant human-derived YBX1 protein, expressed by E. coli, with C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

YBX1 Protein, Human (His) is the recombinant human-derived YBX1 protein, expressed by E. coli, with C-6*His tag.

Background

YB1 is a DNA- and RNA-binding protein involved in various biological processes, including translational repression, RNA stabilization, mRNA splicing, DNA repair, and transcription regulation. It primarily functions as an RNA-binding protein, preferentially binding to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizing mRNA transcripts modified by C5-methylcytosine (m5C). YB1 promotes mRNA stabilization by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay. It is a component of the CRD-mediated complex that enhances MYC mRNA stability. Additionally, YB1 contributes to translation regulation by modulating interactions between mRNA and eukaryotic initiation factors (by similar). It plays a key role in defining the RNA composition of extracellular exosomes by sorting small non-coding RNAs (e.g., tRNAs, Y RNAs, Vault RNAs, and miRNAs) through recognition of m5C-containing RNAs. YB1 also acts as a key effector in epidermal progenitors, preventing senescence by regulating the translation of senescence-associated cytokine mRNAs. It is involved in pre-mRNA alternative splicing regulation by binding to splice sites. Furthermore, YB1 binds DNA, enhancing transcription of the multidrug resistance gene MDR1 in the presence of acetylated APEX1. It exhibits endonucleolytic activity, introducing nicks or breaks into double-stranded DNA, suggesting a role in DNA repair. The secreted form of YB1 functions as an extracellular mitogen, stimulating cell migration and proliferation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • YBX1 (S2-E324)
      Accession # P67809
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    YBX1; Y-Box Binding Protein 1; NSEP1; YB-1; DBPB; YB1; MDR-NF1; NSEP-1; CSDA2; BP-8; CSDB; CCAAT-Binding Transcription Factor I Subunit A; Nuclease-Sensitive Element-Binding Protein 1; Enhancer Factor I Subunit A; Y-Box Transcription Factor; Y-Box-Binding

  • AA Sequence

    SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

  • Predicted Molecular Mass

    42.7 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00