YBX1 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
YBX1 Protein, Human (His) is the recombinant human-derived YBX1 protein, expressed by E. coli, with C-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
YBX1 Protein, Human (His) is the recombinant human-derived YBX1 protein, expressed by E. coli, with C-6*His tag.
Background
YB1 is a DNA- and RNA-binding protein involved in various biological processes, including translational repression, RNA stabilization, mRNA splicing, DNA repair, and transcription regulation. It primarily functions as an RNA-binding protein, preferentially binding to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizing mRNA transcripts modified by C5-methylcytosine (m5C). YB1 promotes mRNA stabilization by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay. It is a component of the CRD-mediated complex that enhances MYC mRNA stability. Additionally, YB1 contributes to translation regulation by modulating interactions between mRNA and eukaryotic initiation factors (by similar). It plays a key role in defining the RNA composition of extracellular exosomes by sorting small non-coding RNAs (e.g., tRNAs, Y RNAs, Vault RNAs, and miRNAs) through recognition of m5C-containing RNAs. YB1 also acts as a key effector in epidermal progenitors, preventing senescence by regulating the translation of senescence-associated cytokine mRNAs. It is involved in pre-mRNA alternative splicing regulation by binding to splice sites. Furthermore, YB1 binds DNA, enhancing transcription of the multidrug resistance gene MDR1 in the presence of acetylated APEX1. It exhibits endonucleolytic activity, introducing nicks or breaks into double-stranded DNA, suggesting a role in DNA repair. The secreted form of YB1 functions as an extracellular mitogen, stimulating cell migration and proliferation.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Biochem Pharmacol
Bufalin reverses oxaliplatin resistance in gastric cancer by targeting YBX1 to suppress glycolysis. [Abstract]2026 Apr 15;250(Pt 1):117976. PMID: 41991006
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P67809 (S2-E324)
-
Gene ID4904
-
Molecular Construction
-
N-term
-
YBX1 (S2-E324)
Accession # P67809 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
YBX1; Y-Box Binding Protein 1; NSEP1; YB-1; DBPB; YB1; MDR-NF1; NSEP-1; CSDA2; BP-8; CSDB; CCAAT-Binding Transcription Factor I Subunit A; Nuclease-Sensitive Element-Binding Protein 1; Enhancer Factor I Subunit A; Y-Box Transcription Factor; Y-Box-Binding
-
AA Sequence
SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
-
Predicted Molecular Mass
42.7 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)