YPR1 Protein, Saccharomyces cerevisiae (His, StrepⅡ)

During the log phase in SD medium, YPR1 protein is detected at a concentration of 14100 molecules per cell, indicating its abundance in the cellular environment under these growth conditions. This quantitative information offers valuable insights into YPR1's expression level and potential roles in cellular processes during logarithmic growth. YPR1 Protein, Saccharomyces cerevisiae (His, Strep) is the recombinant YPR1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

The YPR1 protein is observed to be present at a concentration of 14100 molecules per cell during the log phase in SD medium. This quantitative insight highlights the abundance of YPR1 in the cellular milieu under these specific growth conditions, providing valuable information about the protein's expression level and potential role in cellular processes during logarithmic growth.

Others

E. coli

N-6*His;N-StrepⅡ

Q12458 (P2-Q312)

851974

Partial

PATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.