YPR1 Protein, Saccharomyces cerevisiae
During the log phase in SD medium, YPR1 protein is detected at a concentration of 14100 molecules per cell, indicating its abundance in the cellular environment under these growth conditions. This quantitative information offers valuable insights into YPR1's expression level and potential roles in cellular processes during logarithmic growth. YPR1 Protein, Saccharomyces cerevisiae is the recombinant YPR1 protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
During the log phase in SD medium, YPR1 protein is detected at a concentration of 14100 molecules per cell, indicating its abundance in the cellular environment under these growth conditions. This quantitative information offers valuable insights into YPR1's expression level and potential roles in cellular processes during logarithmic growth. YPR1 Protein, Saccharomyces cerevisiae is the recombinant YPR1 protein, expressed by E. coli , with tag free.
Background
The YPR1 protein is observed to be present at a concentration of 14100 molecules per cell during the log phase in SD medium. This quantitative insight highlights the abundance of YPR1 in the cellular milieu under these specific growth conditions, providing valuable information about the protein's expression level and potential role in cellular processes during logarithmic growth.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q12458 (P2-Q312)
-
Gene ID851974
-
Molecular Construction
-
N-term
-
YPR1 (P2-Q312)
Accession # Q12458 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
YPR1; YDR368W; D9481.8; Aldehyde reductase YPR1; EC 1.1.1.2; 2-methylbutyraldehyde reductase
-
AA Sequence
PATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
