1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. YPR1 Protein, Saccharomyces cerevisiae

During the log phase in SD medium, YPR1 protein is detected at a concentration of 14100 molecules per cell, indicating its abundance in the cellular environment under these growth conditions. This quantitative information offers valuable insights into YPR1's expression level and potential roles in cellular processes during logarithmic growth. YPR1 Protein, Saccharomyces cerevisiae is the recombinant YPR1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

During the log phase in SD medium, YPR1 protein is detected at a concentration of 14100 molecules per cell, indicating its abundance in the cellular environment under these growth conditions. This quantitative information offers valuable insights into YPR1's expression level and potential roles in cellular processes during logarithmic growth. YPR1 Protein, Saccharomyces cerevisiae is the recombinant YPR1 protein, expressed by E. coli , with tag free.

Background

The YPR1 protein is observed to be present at a concentration of 14100 molecules per cell during the log phase in SD medium. This quantitative insight highlights the abundance of YPR1 in the cellular milieu under these specific growth conditions, providing valuable information about the protein's expression level and potential role in cellular processes during logarithmic growth.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

Q12458 (P2-Q312)

Gene ID

851974

Molecular Construction
N-term
YPR1 (P2-Q312)
Accession # Q12458
C-term
Protein Length

Partial

Synonyms
YPR1; Putative reductase 1
AA Sequence

PATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

YPR1 Protein, Saccharomyces cerevisiae Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

YPR1 Protein, Saccharomyces cerevisiae

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
YPR1 Protein, Saccharomyces cerevisiae
Cat. No.:
HY-P701990
Quantity:
MCE Japan Authorized Agent: