ZG16B Protein, Human (HEK293, His)

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag.

Zymogen granule protein 16 homolog B enables carbohydrate binding activity. Zymogen granule protein 16 homolog B Involves in retina homeostasis. Zymogen granule protein 16 homolog B locates in extracellular exosome^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC₅₀ is ≤95 ng/mL.

• 
  Immobilized Human ZG16B at 2 μg/mL (100 μL/well) can bind Anti- ZG16B antibody. The ED₅₀ for this effect is 59.89 ng/mL.

Human

HEK293

C-10*His

Q96DA0 (G17-R172)

124220  [NCBI]

Full Length of Mature Protein

GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Approximately 24-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Escudero-Paniagua B,et al. PAUF/ZG16B promotes colorectal cancer progression through alterations of the mitotic functions and the Wnt/β-catenin pathway. Carcinogenesis. 2020 Apr 22;41(2):203-213.  [Content Brief]

  [2]. Ghosh S, et al. Human oral lectin ZG16B acts as a cell wall polysaccharide probe to decode host-microbe interactions with oral commensals. Proc Natl Acad Sci U S A. 2023 May 30;120(22):e2216304120.  [Content Brief]

  [3]. Yoo W, et al. Pancreatic cancer induces muscle wasting by promoting the release of pancreatic adenocarcinoma upregulated factor. Exp Mol Med. 2021 Mar;53(3):432-445.  [Content Brief]