Copy Link Print Information

ZG16B Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ZG16B Protein, Human (HEK293, His)
  • Experimental Validation Results for ZG16B Protein, Human (HEK293, His)
  • ZG16B Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Zymogen granule protein 16 homolog B enables carbohydrate binding activity. Zymogen granule protein 16 homolog B Involves in retina homeostasis. Zymogen granule protein 16 homolog B locates in extracellular exosome[1][2][3].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is ≤95 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human ZG16B at 2 μg/mL (100 μL/well) can bind Anti- ZG16B antibody. The ED50 for this effect is 59.89 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q96DA0 (G17-R172)

  • Gene ID
    124220  [NCBI]
  • Molecular Construction
    • N-term
    • ZG16B (G17-R172)
      Accession # Q96DA0
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ZG16B; Zymogen Granule Protein 16B; Zymogen Granule Protein 16 Homolog B; HRPE773; PRO1567; JCLN2; Pancreatic Adenocarcinoma Up-Regulated Factor; Jacalin-Like Lectin Domain Containing 2; PAUF; Pancreatic Adenocarcinoma Upregulated Factor; Zymogen Granule

  • AA Sequence

    GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

  • Predicted Molecular Mass

    17.2 kDa

  • Molecular Weight

    Approximately 24-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Escudero-Paniagua B,et al. PAUF/ZG16B promotes colorectal cancer progression through alterations of the mitotic functions and the Wnt/β-catenin pathway. Carcinogenesis. 2020 Apr 22;41(2):203-213. [Content Brief]

[2]. Ghosh S, et al. Human oral lectin ZG16B acts as a cell wall polysaccharide probe to decode host-microbe interactions with oral commensals. Proc Natl Acad Sci U S A. 2023 May 30;120(22):e2216304120. [Content Brief]

[3]. Yoo W, et al. Pancreatic cancer induces muscle wasting by promoting the release of pancreatic adenocarcinoma upregulated factor. Exp Mol Med. 2021 Mar;53(3):432-445. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human ZG16B at 2 μg/mL (100 μL/well) can bind Anti- ZG16B antibody. The ED50 for this effect is 59.89 ng/mL.

  • ZG16B Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for ZG16B Protein, Human (HEK293, His)
  • Experimental Validation Results for ZG16B Protein, Human (HEK293, His)
  • ZG16B Protein, Human (HEK293, His) Product Image