ZG16B Protein, Human (HEK293, His)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
20 μg	$150	In-stock	Estimated Time of Arrival: December 31
50 μg	$300	In-stock	Estimated Time of Arrival: December 31
100 μg	$510	In-stock	Estimated Time of Arrival: December 31
> 100 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody, the EC₅₀ is ≤46.04 ng/mL.
Species	Human
Source	HEK293
Tag	C-10*His
Accession	Q96DA0 (G53-R208)
Gene ID	124220 [NCBI]
Molecular Construction	N-term ZG16B (G53-R208) Accession # Q96DA0 10*His C-term
Synonyms	EECP; PAUF; JCLN2; HRPE773; PRO1567
AA Sequence	GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Molecular Weight	Approximately 26 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder.
Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (221 KB) Handling Instructions (2659 KB)

ZG16B Protein, Human (HEK293, His) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.