MLH40
MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodomain region of DENV membrane protein. MLH40 inhibits DENV through its N-terminal loop interaction with DENV envelope protein and altering the dimer conformation.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C209H325N61O58S2
- Molecular Weight:4684.32
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
Chemical Information
-
Molecular Weight 4684.32
-
Formel C209H325N61O58S2
-
Sequence
Ser-Val-Ala-Leu-Val-Pro-His-Val-Gly-Met-Gly-Leu-Glu-Thr-Arg-Thr-Glu-Thr-Trp-Met-Ser-Ser-Glu-Gly-Ala-Trp-Lys-His-Val-Gln-Arg-Ile-Glu-Thr-Trp-Ile-Leu-Arg-His-Pro-Gly
-
Sequence Shortening
SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Protokoll
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Membrane Protein Extraction Using Detergents and Chaotropes
Membrane protein extraction with detergents and chaotropes solubilizes lipid-bilayer-associated proteins by disrupting protein-lipid and protein-protein interactions while maintaining proteins in a soluble state for downstream electrophoresis, purification, or mass spectrometry. Chaotropes such as urea and thiourea improve solubilization of difficult proteins, while nonionic and zwitterionic detergents such as CHAPS, ASB-14, SB 3-10, MEGA-10, dodecyl maltoside, and Triton X-100 differ in extraction efficiency depending on sample type and membrane protein properties.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)