1. GPCR/G Protein
  2. Angiotensin Receptor
  3. C-Type Natriuretic Peptide (1-53), human

C-Type Natriuretic Peptide (1-53), human 

Cat. No.: HY-P1815
Handling Instructions

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

C-Type Natriuretic Peptide (1-53), human Chemical Structure

C-Type Natriuretic Peptide (1-53), human Chemical Structure

CAS No. : 141294-77-1

Size Stock
1 mg   Get quote  
5 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone[1].

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
Molecular Weight

5801.77

Formula

C₂₅₁H₄₁₇N₈₁O₇₁S₃

CAS No.

141294-77-1

Sequence

{Asp}{Leu}{Arg}{Val}{Asp}{Thr}{Lys}{Ser}{Arg}{Ala}{Ala}{Trp}{Ala}{Arg}{Leu}{Leu}{Gln}{Glu}{His}{Pro}{{Asn}{Ala}{Arg}{Lys}{Tyr}{Lys}{Gly}{Ala}{Asn}{Lys}{Lys}{Gly}{Leu}{Ser}{Lys}{Gly}{Cys}{Phe}{Gly}{Leu}{Lys}{Leu}{Asp}{Arg}{Ile}{Gly}{Ser}{Met}{Ser}{Gly}{Leu}{Gly}{Cys}

Sequence Shortening

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C-Type Natriuretic Peptide (1-53), human
Cat. No.:
HY-P1815
Quantity:

C-Type Natriuretic Peptide (1-53), human

Cat. No.: HY-P1815