C-Type Natriuretic Peptide (1-53), human TFA
Based on 1 Customer Validation
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
For research use only. We do not sell to patients.
- Purity: 99.94%
- Formula: C251H417N81O71S3.xC2HF3O2
- Molecular Weight:5801.77 (free acid)
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
All Angiotensin Receptor Isoforms
More
Biological Activity
Chemical Information
-
Appearance Solid
-
Molecular Weight 5801.77 (free acid)
-
Formula C251H417N81O71S3.xC2HF3O2
-
Color White to off-white
-
Sequence
Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys37-Cys55)
-
Sequence Shortening
DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
H2O : 50 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)