Cecropin D
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 83652-32-8
- Formule: C180H293N55O51
- Masse moléculaire:4043.59
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Chemical Information
-
CAS No. 83652-32-8
-
Masse moléculaire 4043.59
-
Formule C180H293N55O51
-
Sequence
Trp-Asn-Pro-Phe-Lys-Glu-Leu-Glu-Lys-Val-Gly-Gln-Arg-Val-Arg-Asp-Ala-Val-Ile-Ser-Ala-Gly-Pro-Ala-Val-Ala-Thr-Val-Ala-Gln-Ala-Thr-Ala-Leu-Ala-Lys-Asn-His-NH2
-
Sequence Shortening
WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
[1]. Asma Hussain Alkatheri, et al. Host-Bacterial Interactions: Outcomes of Antimicrobial Peptide Applications. Membranes (Basel). 2022 Jul 19;12(7):715. [Content Brief]
[2]. Jian Peng, et al. Antimicrobial functional divergence of the cecropin antibacterial peptide gene family in Musca domestica. Parasit Vectors. 2019 Nov 14;12(1):537. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Cecropin D Related Classifications
HY-P3365 Related Classifications
Powered by Bioz