CD40 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Activité biologique
Description
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CD40 Protein, acting as the receptor for TNFSF5/CD40LG, is instrumental in transducing signals through TRAF6- and MAP3K8-mediated pathways, leading to the activation of ERK in macrophages and B cells and subsequent induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein exhibits variations in its homodimeric structure, as observed in the bladder carcinoma cell line Hu549. The receptor interacts with key signaling molecules such as TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, with the crucial interaction occurring between CD40 Protein, TRAF6, and MAP3K8, thereby playing a pivotal role in ERK activation.
Verified Bioactivity
Immobilized Biotinylated Human CD40 His at 1 μg/mL (100μL/Well) on the plate. Dose response curve for Human CD40 Ligand (Trimer) hFc Tag with the EC50 is 1.0-100.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P25942-1 (E21-R193)
-
Molecular Construction
-
N-term
-
CD40 (E21-R193)
Accession # P25942-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
-
Predicted Molecular Mass
22.1 kDa
-
Masse moléculaire
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Pureté
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)