2. GPCR/G Protein Others
  3. Natriuretic Peptide Receptor (NPR) Drug Derivative
  4. CNP analogue-1

CNP analogue-1 is a long-acting, low-isoelectric point C-type natriuretic peptide (CNP) analog. CNP analogue-1 activates human natriuretic peptide receptor 2 (hNPR2) with an EC50 of 0.18 nM. CNP analogue-1 stimulates cGMP production and is resistant to neprilysin-mediated degradation. CNP analogue-1 induces baroreceptor-mediated heart rate elevation and enhances the maximal rates of cardiac contraction and relaxation. CNP analogue-1 can be used in the research of heart failure with preserved ejection fraction.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CNP analogue-1

CNP analogue-1 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

CNP analogue-1 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

CNP analogue-1 is a long-acting, low-isoelectric point C-type natriuretic peptide (CNP) analog. CNP analogue-1 activates human natriuretic peptide receptor 2 (hNPR2) with an EC50 of 0.18 nM. CNP analogue-1 stimulates cGMP production and is resistant to neprilysin-mediated degradation. CNP analogue-1 induces baroreceptor-mediated heart rate elevation and enhances the maximal rates of cardiac contraction and relaxation. CNP analogue-1 can be used in the research of heart failure with preserved ejection fraction[1].

In Vitro

CNP analogue-1 (Compound 65) (0.1 pM-200 nM; 30 min) potently activates NPR2 in stably transfected HEK293 cells with an EC50 of 0.18 nM[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

CNP analogue-1 Related Antibodies
Parmacokinetics
Species Dose Route T1/2 F CL
Rat[1] 102 nmol/Kg i.v. 14.5 h / 0.00549 L/h/kg
Rat[1] 323 nmol/Kg s.c. 18.6 h 71.5 % /
Pig[1] 60 nmol/Kg i.v. 89 h / 1.07 mL/h/kg
Pig[1] 45 nmol/Kg s.c. 84 h 89 % /
In Vivo

CNP analogue-1 (Compound 65) (200 nmol/kg; intravenous bolus) significantly enhances myocardial systolic and diastolic function in healthy male Sprague-Dawley rats without altering heart rate, indicating its potential to improve cardiac dynamics in patients with heart failure with preserved ejection fraction[1].
CNP analogue-1 (102-323 nmol/kg; intravenous injection; subcutaneous injection) exhibits a prolonged plasma elimination half-life and high subcutaneous bioavailability in healthy male Sprague-Dawley rats, and achieves detectable target engagement via elevation of cGMP[1].
CNP analogue-1 (45-60 nmol/kg; intravenous injection; subcutaneous injection) exhibits a long plasma elimination half-life and high subcutaneous bioavailability in healthy female Göttingen minipigs, supporting its potential for once-weekly administration[1].
CNP analogue-1 (30-300 nmol/kg; intravenous bolus injection) exhibits favorable acute hemodynamic profiles in healthy male Sprague-Dawley rats, with no change in MAP and only a slight, statistically significant increase in HR observed at the two highest tested doses[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague-Dawley (male, 10-12 weeks old at arrival, with telemetry implants)[1]
Dosage: 200 nmol/kg
Administration: i.v. bolus
Result: Significantly increased the maximal rate of cardiac contraction and relaxation.
Showed no significant change in heart rate post-dosing.
Molecular Weight

4828.44

Formula

C211H341N57O68S2
Sequence

{C18 diacid-γ-Glu-γ-Glu-γ-Glu-γ-Glu-γ-Glu}-QEHPQARKYKGAQKKGLSSGCFGLPLDRIGSLSGLGC (Disulfide bridge: Cys21-Cys37)
Sequence Shortening

{C18 diacid-γ-Glu-γ-Glu-γ-Glu-γ-Glu-γ-Glu}-Gln-Glu-His-Pro-Gln-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Gln-Lys-Lys-Gly-Leu-Ser-Ser-Gly-Cys-Phe-Gly-Leu-Pro-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys21-Cys37)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

CNP analogue-1 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

CNP analogue-1CNP analogue1CNP analogue 1Natriuretic Peptide Receptor (NPR)Drug DerivativeNatriuretic Peptide ReceptorNPRNPR-ANPR-BNPR-CDrug derivativehumancGMPHEK293 cellsbaroreceptorneprilysinG?ttingen minipigsheart failure with preserved ejection fractionnatriuretic peptide receptor 2Sprague-Dawley ratsratInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNP analogue-1
Cat. No.:
HY-P11861
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.