CNP analogue-1
CNP analogue-1 is a long-acting, low-isoelectric point C-type natriuretic peptide (CNP) analog. CNP analogue-1 activates human natriuretic peptide receptor 2 (hNPR2) with an EC50 of 0.18 nM. CNP analogue-1 stimulates cGMP production and is resistant to neprilysin-mediated degradation. CNP analogue-1 induces baroreceptor-mediated heart rate elevation and enhances the maximal rates of cardiac contraction and relaxation. CNP analogue-1 can be used in the research of heart failure with preserved ejection fraction.
For research use only. We do not sell to patients.
- Formula: C211H341N57O68S2
- Molecular Weight:4828.44
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vitro
CNP analogue-1 (Compound 65) (0.1 pM-200 nM; 30 min) potently activates NPR2 in stably transfected HEK293 cells with an EC50 of 0.18 nM[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Parmacokinetics
In Vivo
CNP analogue-1 (102-323 nmol/kg; intravenous injection; subcutaneous injection) exhibits a prolonged plasma elimination half-life and high subcutaneous bioavailability in healthy male Sprague-Dawley rats, and achieves detectable target engagement via elevation of cGMP[1].
CNP analogue-1 (45-60 nmol/kg; intravenous injection; subcutaneous injection) exhibits a long plasma elimination half-life and high subcutaneous bioavailability in healthy female Göttingen minipigs, supporting its potential for once-weekly administration[1].
CNP analogue-1 (30-300 nmol/kg; intravenous bolus injection) exhibits favorable acute hemodynamic profiles in healthy male Sprague-Dawley rats, with no change in MAP and only a slight, statistically significant increase in HR observed at the two highest tested doses[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dawley (male, 10-12 weeks old at arrival, with telemetry implants)[1]
-
Dosage:200 nmol/kg
-
Administration:i.v. bolus
-
Result:Significantly increased the maximal rate of cardiac contraction and relaxation.
Showed no significant change in heart rate post-dosing.
Chemical Information
-
Molecular Weight 4828.44
-
Formula C211H341N57O68S2
-
Sequence
{C18 diacid-γ-Glu-γ-Glu-γ-Glu-γ-Glu-γ-Glu}-QEHPQARKYKGAQKKGLSSGCFGLPLDRIGSLSGLGC (Disulfide bridge: Cys21-Cys37)
-
Sequence Shortening
{C18 diacid-γ-Glu-γ-Glu-γ-Glu-γ-Glu-γ-Glu}-Gln-Glu-His-Pro-Gln-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Gln-Lys-Lys-Gly-Leu-Ser-Ser-Gly-Cys-Phe-Gly-Leu-Pro-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys21-Cys37)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)