Copy Link Print Information

AGRP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for AGRP Protein, Human (HEK293, His)
  • AGRP Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

Background

The AGRP protein plays a crucial role in weight homeostasis and is integral to the regulation of feeding behavior through the central melanocortin system. Functioning as an alpha melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production mediated by the stimulation of melanocortin receptors within the hypothalamus and adrenal gland. While exhibiting minimal activity with MC5R, AGRP serves as an inverse agonist for MC3R and MC4R, suppressing their constitutive activity. Moreover, AGRP promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner, underscoring its intricate involvement in modulating the activity of melanocortin receptors. The interaction of AGRP with MC3R, MC4R, and MC5R further highlights its regulatory role in the melanocortin signaling pathway, positioning it as a key player in the intricate balance of weight regulation and feeding control.

Verified Bioactivity

Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically ≤0.1019 µg/mL, corresponding to a specific activity is ≥9813.543 U/mg, in the presence of 10 ng/mL of alpha-MSH(HY-P0252).

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically 0.1019 µg/mL, corresponding to a specific activity is 9813.543 U/mg, in the presence of 10 ng/mL of alpha -MSH.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    O00253 (A21-T132)

  • Gene ID
    181  [NCBI]
  • Molecular Construction
    • N-term
    • AGRP (A21-T132)
      Accession # O00253
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein (with Propeptide)

  • Synonyms

    AGRP; Agrt; Agouti Related Neuropeptide; Agouti Related Protein Homolog (Mouse); ART; Agouti (Mouse) Related Protein; Agouti-Related Protein; Agouti Related Protein Homolog; ASIP2; AGRT

  • AA Sequence

    AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

  • Molecular Weight

    Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 5% trehalose, 5% mannitol, 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically 0.1019 µg/mL, corresponding to a specific activity is 9813.543 U/mg, in the presence of 10 ng/mL of alpha -MSH.

  • AGRP Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for AGRP Protein, Human (HEK293, His)
  • AGRP Protein, Human (HEK293, His) Product Image