1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ENTPD3 Protein, Human (sf9, His)

The ENTPD3 protein exhibits unique enzymatic preferences, with triple hydrolysis specificity for ATP hydrolysis and triple specificity for ADP hydrolysis. This shows a clear affinity for ATP substrate hydrolysis, suggesting a critical role in cellular processes involving the breakdown of ATP molecules. ENTPD3 Protein, Human (sf9, His) is the recombinant human-derived ENTPD3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The ENTPD3 protein exhibits unique enzymatic preferences, with triple hydrolysis specificity for ATP hydrolysis and triple specificity for ADP hydrolysis. This shows a clear affinity for ATP substrate hydrolysis, suggesting a critical role in cellular processes involving the breakdown of ATP molecules. ENTPD3 Protein, Human (sf9, His) is the recombinant human-derived ENTPD3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The ENTPD3 protein, demonstrates a notable threefold preference for the hydrolysis of ATP (adenosine triphosphate) over ADP (adenosine diphosphate). This enzymatic specificity implies a particular affinity for cleaving the high-energy phosphate bonds in ATP, highlighting its role in the hydrolysis of this essential nucleotide triphosphate. The preference for ATP hydrolysis suggests that ENTPD3 may play a significant role in regulating cellular energy dynamics, potentially participating in cellular processes that require ATP as an energy source. Further investigations may provide insights into the specific cellular pathways and functions associated with ENTPD3's enzymatic activity and its impact on cellular bioenergetics.

Biological Activity

Measured by its ability to hydrolyze the 5’-phosphate group from the substrate adenosine-5’-triphosphate (ATP) and the specific activity is >70,000 pmol/min/µg.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

O75355 (Q44-P485)

Gene ID

956  [NCBI]

Molecular Construction
N-term
ENTPD3 (Q44-P485)
Accession # O75355
His
C-term
Protein Length

Extracellular Domain

Synonyms
Ectonucleoside triphosphate diphosphohydrolase 3; NTPDase 3; Ecto-apyrase 3; CD39L3
AA Sequence

QIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPP

Molecular Weight

Approximately 50 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

ENTPD3 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ENTPD3 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ENTPD3 Protein, Human (sf9, His)
Cat. No.:
HY-P76904
Quantity:
MCE Japan Authorized Agent: