Glutamine synthetase/GLUL Protein, Human (His)

Customer Review

Based on 1 Customer Validation

GLUL proteins catalyze the conversion of glutamate and ammonia to glutamine. Glutamine synthetase/GLUL Protein, Human (His) is the recombinant human-derived Glutamine synthetase/GLUL protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GLUL proteins catalyze the conversion of glutamate and ammonia to glutamine. Glutamine synthetase/GLUL Protein, Human (His) is the recombinant human-derived Glutamine synthetase/GLUL protein, expressed by E. coli , with C-6*His labeled tag.

Background

Glutamine synthetase/GLUL Protein serves as a crucial enzyme catalyzing the ATP-dependent conversion of glutamate and ammonia to glutamine. Its functional significance varies with tissue localization; in the brain, it plays a pivotal role in regulating levels of toxic ammonia and converting neurotoxic glutamate to harmless glutamine. Conversely, in the liver, GLUL is integral to the enzymatic machinery responsible for ammonia removal. Beyond its classical role in glutamine synthesis, GLUL exhibits diverse functions. It is essential for the proliferation of fetal skin fibroblasts and independently contributes to endothelial cell migration during vascular development by regulating membrane localization and activation of the GTPase RHOJ, potentially through promoting RHOJ palmitoylation. Furthermore, GLUL may act as a palmitoyltransferase for RHOJ, demonstrating autopalmitoylation capability and subsequent transfer of the palmitoyl group to RHOJ. Additionally, GLUL plays a role in ribosomal 40S subunit biogenesis. The multifaceted activities of GLUL underscore its importance in various cellular processes, highlighting its versatility in both metabolic and regulatory contexts.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GLUL (T2-N373)
      Accession # P15104
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GLUL; Proliferation-Inducing Protein 43; Prev. GLNS; Glutamate Decarboxylase; Glutamine Synthetase; Glutamine Synthase; Palmitoyltransferase GLUL; DEE116; GS; PIG43; Glutamate-Ammonia Ligase (Glutamine Synthase); PIG59; Cell Proliferation-Inducing Protein

  • AA Sequence

    TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

  • Predicted Molecular Mass

    43.1 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 50 mM Imidazole, pH 8.0 or 20mM Citrate,100mM NaCl,8%Trehalose,10%Glycerol,0.03%Tween80,pH5.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00