IL-15 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
IL-15 Protein, Human (His) is a cytokine for immune cell stimulation, increases the proliferation and persistence of natural killer (NK) and T cells.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-15 Protein, Human (His) is a cytokine for immune cell stimulation, increases the proliferation and persistence of natural killer (NK) and T cells.
Background
Interleukin-15 is a highly attractive cytokine for immune cell stimulation because it can increase the proliferation and persistence of natural killer (NK) and T cells[1].
Verified Bioactivity
1.The ED50 is <0.5 ng/mL as measured by CTLL-2 cells, corresponding to a specific activity of >2 × 106 units/mg.
2.Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 2.380 ng/mL, corresponding to a specific activity is 4.202×10105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Mol Ther Oncol
Epstein-Barr virus mRNA vaccine synergizes with NK cells to enhance nasopharyngeal carcinoma eradication in humanized mice. [Abstract]2025 Apr 24;33(2):200986. PMID: 40458686
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P40933-1 (N49-S162)
-
Molecular Construction
-
N-term
-
His
-
IL-15 (N49-S162)
Accession # P40933-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL15; Interleukin-15; Interleukin 15; MGC9721; IL-15
-
AA Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
-
Predicted Molecular Mass
12.8 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized after extensive dialysis against PBS.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)