LIF Protein, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

The LIF protein possesses the capacity to induce terminal differentiation in leukemic cells. Its diverse range of activities encompasses the induction of hematopoietic differentiation in both normal and myeloid leukemia cells, prompting neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. These multifaceted activities underscore LIF's role in influencing cellular differentiation across various cell types and physiological contexts.

1.Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells and the ED₅₀ is typically 0.2-0.8 ng/mL.
2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀  for this effect is 0.004-0.1 ng/mL.
3.Immobilized Human LIF at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Human LIF R, hFc Tag with the EC₅₀ of ≤0.12 μg/mL determined by ELISA.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.004534 ng/mL, corresponding to a specific activity is 2.206×10⁸ units/mg.

Human

HEK293

Tag Free

P15018-1 (S23-F202)

3976  [NCBI]

Full Length of Isoform-1 Mature Protein

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/hl-60-cell.html  [Content Brief]