MCP-4/CCL13 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

MCP-4/CCL13 Protein, Human is a CC family chemokine with chemotactic effects on basophils, monocytes, macrophages, immature dendritic cells and T cells. CCL13 binds to CCR1, CCR2, CCR3, CCR5, and CCR11 chemokine receptors and is able to induce key immunomodulatory responses through its effects on regulatory muscle, epithelial, and endothelial cells. MCP-4/CCL13 Protein, Human is a recombinant human MCP-4/CCL13 (Q24-T98) protein expressed by E.coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MCP-4/CCL13 Protein, Human is a CC family chemokine with chemotactic effects on basophils, monocytes, macrophages, immature dendritic cells and T cells. CCL13 binds to CCR1, CCR2, CCR3, CCR5, and CCR11 chemokine receptors and is able to induce key immunomodulatory responses through its effects on regulatory muscle, epithelial, and endothelial cells. MCP-4/CCL13 Protein, Human is a recombinant human MCP-4/CCL13 (Q24-T98) protein expressed by E.coli[1][2].

Background

CCL13, also known as monocyte chemotactic protein MCP-4, is a small cell factor belonging to the CC chemokine family and is located on human chromosome 17. At the amino acid level, human CCL13 shares 65% identity with human CCL2. CCL13 can act as a chemoattractant for monocytes, macrophages, T lymphocytes, immature DCs, eosinophils, and basophils by binding to cell surface G protein-linked chemokine receptors such as CCR1, CCR2, CCR3, CCR5, and CCR11. CCL13 also induces histamine release from basophils and eosinophil degranulation, and causes expression of adhesion molecules and production of pro-inflammatory cytokines in endothelial cells, epithelial cells and muscle cells[1]. CCL13 plays a role in leukocyte accumulation on both sides of allergic and non-allergic inflammation. Studies have shown that CCL13 is upregulated in asthma and allergic rhinitis and is associated with the number of monocytes/macrophages and eosinophils recruited in the airways of patients. It may be involved in the recruitment of monocytes to the arterial wall during atherosclerotic disease and plays a role in the attraction of monocytes in tissues chronically exposed to exogenous pathogens. ccl13 may also contribute to the development of drug resistance in tumor cells by promoting apoptosis and drug resistance[2].

Verified Bioactivity

1. Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 10-100 ng/mL.
2. Measured by its ability to chemoattract THP-1 cells. The ED50 this effect is 18.2 ng/mL, corresponding to a specific activity is 5.49×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 18.2 ng/mL, corresponding to a specific activity is 5.49×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL13 (Q24-T98)
      Accession # Q99616
    • C-term
  • Protein Length

    Full Length of C-C motif chemokine 13, short Chain

  • Synonyms

    CCL13; Monocyte Chemotactic Protein 4; Prev. SCYA13; C-C Motif Chemokine 13; MCP-4; CK-Beta-10; NCC-1; MGC17134; SCYL1; NCC1; CKb10; Chemokine (C-C Motif) Ligand 13, Isoform CRA_a; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 13; New CC Chemokin

  • AA Sequence

    QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

  • Predicted Molecular Mass

    8.6 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00