MFAP4 Protein, Mouse (HEK293, His-Flag)
Based on 1 Customer Validation
MFAP4 Protein participates in calcium-dependent cell adhesion or intercellular interactions and may contribute to elastic fiber assembly and maintenance. It forms homodimers and higher oligomers, interacting with FBN1, FBN2, LOX, COL1A1, and ELN in a calcium-dependent manner, promoting ELN self-assembly. MFAP4 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MFAP4 Protein participates in calcium-dependent cell adhesion or intercellular interactions and may contribute to elastic fiber assembly and maintenance. It forms homodimers and higher oligomers, interacting with FBN1, FBN2, LOX, COL1A1, and ELN in a calcium-dependent manner, promoting ELN self-assembly. MFAP4 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.
Background
MFAP4 protein is implicated in potential roles related to calcium-dependent cell adhesion or intercellular interactions. It is suggested to play a role in the assembly and/or maintenance of elastic fibers, contributing to the dynamic processes associated with these structures. MFAP4 can form homodimers and higher-order oligomers, and it interacts with proteins such as FBN1, FBN2, LOX, COL1A1, and ELN in a calcium-dependent manner. Notably, its interaction with ELN promotes the self-assembly of elastin, emphasizing its involvement in structural processes associated with extracellular matrix components.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-8*His;N-Flag
-
Accession
Q9D1H9-1 (Q23-A257)
-
Molecular Construction
-
N-term
-
8*His-Flag
-
MFAP4 (Q23-A257)
Accession # Q9D1H9-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MFAP4; Microfibril-Associated Glycoprotein 4; Microfibril Associated Protein 4; Microfibrillar Associated Protein 4
-
AA Sequence
QASGIRGDALEKSCLQQPLDCDDIYAQGYQEDGVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWSDYKLGFGRADGEYWLGLQNLHLLTLKQKYELRVDLEDFENNTAYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
-
Predicted Molecular Mass
28.7 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
