MDC/CCL22 Protein, Rat
Based on 1 Customer Validation
CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC(G25-A92) protein expressed by E. coli.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC(G25-A92) protein expressed by E. coli[1][2].
Background
CCL22, also known as macrophage-derived chemokine (MDC), a CC chemokine located on chromosome 16 in the human genome, is a protein encoded by the CCL22 gene that shares 37% identity with CCL17 at the amino acid level. CCL22 is secreted by dendritic cells and macrophages and can be upregulated by a variety of stimulatory factors, such as lipopolysaccharides, cytokines. Among them, the Th2 cytokines IL-4 and IL-13 induce CCL22 production in myeloid cells and can be inhibited by the Th1 cytokine IFN-γ. In addition to acting as a potent chemotactic agent for CCR4-expressing Th2 lymphocytes, monocytes, monocyte-derived dendritic cells, and natural killer cells, CCL22 can also affect its target cells by interacting with the chemokine receptor CCR4. CCL22 is a potent inducer of CCR4 internalization, and CCL22 binding to CCR4 reduces the subsequent functional response of CCR4. The interaction of CCL22 with CCR4 is involved in a variety of pathologies, ranging from allergic reactions and autoimmunity to tumor growth. In contrast, small molecule compounds and antibodies capable of blocking CCL17 and CCL22-mediated recruitment of Th2 and Treg cells have been shown to have positive effects in various disease models of asthma, atopic disease and tumor growth. In addition, an important role of CCL22 and its receptors in TH2 lymphocyte recruitment has been shown in models of allergic airway inflammation. It can also be involved in thymopoiesis by regulating the migration of mature thymocytes through this organ[1][2].
In Vivo
CCL22 expression is selectively upregulated in the rat model of radiation pneumonia/pulmonary fibrosis, and increased CCL22 expression is also observed in some alveolar macrophages in the lungs of the radiotherapy group[3].
Verified Bioactivity
Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR4. The ED50 for this effect is 2.935 ng/mL, corresponding to a specific activity is 3.407×10^5 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q5I0L5 (G25-A92)
-
Molecular Construction
-
N-term
-
MDC (G25-A92)
Accession # Q5I0L5 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL22; Macrophage-Derived Chemokine; Prev. SCYA22; CC Chemokine STCP-1; MDC; MDC(1-69); A-152E5.1; MGC34554; DC/B-CK; Stimulated T Cell Chemotactic Protein 1; STCP-1; Stimulated T-Cell Chemotactic Protein 1; ABCD-1; Small Inducible Cytokine A22; Small Ind
-
AA Sequence
GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
-
Predicted Molecular Mass
7.9 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21(21):8412. [Content Brief]
[2]. Yano C, et al. Mechanism of Macrophage-Derived Chemokine/CCL22 Production by HaCaT Keratinocytes. Ann Dermatol. 2015 Apr;27(2):152-6. [Content Brief]
[3]. Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18(11):2306. [Content Brief]
[4]. T Inoue, et al. CCL22 and CCL17 in rat radiation pneumonitis and in human idiopathic pulmonary fibrosis. Eur Respir J. 2004 Jul;24(1):49-56. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)