Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Uteroglobin/SCGB1A1 protein, expressed by HEK293 , with C-6*His labeled tag.

The Uteroglobin/SCGB1A1 Protein exhibits versatile binding capabilities, interacting with phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and displaying weak binding to progesterone. Additionally, it acts as a potent inhibitor of phospholipase A2. Structurally, Uteroglobin forms an antiparallel homodimer, held together by disulfide linkages. However, the reported interaction with LMBR1L remains controversial, emphasizing the need for further investigation into this specific molecular association. The multifaceted binding properties of Uteroglobin underscore its potential role in diverse cellular processes, including lipid metabolism and inflammatory responses.

Mouse

HEK293

C-6*His

Q06318 (D22-F96)

22287  [NCBI]

Full Length of Mature Protein

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Approximately 9.0 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. /biology-dictionary/sk-n-mc-cell.html  [Content Brief]