Copy Link Print Information

SFRP2 Protein, Human (HEK293, His, solution)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His, solution) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for SFRP2 Protein, Human (HEK293, His, solution)
  • SFRP2 Protein, Human (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His, solution) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Secreted frizzled-related protein 2 (SFRP2) is a soluble frizzled-related protein that activates the Wnt/β-catenin signaling pathway through DNA demethylation regulation. SFRP2 contains a cysteine-rich domain that is a soluble regulator of Wnt signaling. SFRP2 can differentiate human induced pluripotent stem cells into mature cardiomyocytes. Overexpression of SFRP2 induces osteoblast-like phenotype in prostate cancer cells. SFRP2 promotes carcinogenesis and radiation resistance of glioma cells by activating the Wnt/β-catenin signaling pathway. SFRP2 promoter is hypermethylated in a variety of malignancies and overexpressed in a variety of tumor cells, which may be associated with tumorigenesis. SFRP2 can be used as a non-invasive biomarker for HBV-associated hepatocellular carcinoma[1][2][3][4][5].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession

    Q96HF1 (L25-C295)

  • Gene ID
    6423  [NCBI]
  • Molecular Construction
    • N-term
    • SFRP2 (L25-C295)
      Accession # Q96HF1
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SFRP2; Secreted Apoptosis-Related Protein 1; Secreted Frizzled Related Protein 2; SARP-1; SARP1; SFRP-2; FRP-2; Secreted Apoptosis Related Protein 1; Secreted Frizzled-Related Protein 2; Testicular Tissue Protein Li 170; SDF-5; FRP2

  • AA Sequence

    LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

  • Predicted Molecular Mass

    32.4 kDa

  • Molecular Weight

    Approximately 34-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PBS, 100 mM Larginine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • SFRP2 Protein, Human (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for SFRP2 Protein, Human (HEK293, His, solution)
  • SFRP2 Protein, Human (HEK293, His, solution) Product Image