PGAM5 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PGAM5 Protein, Human (His) is the recombinant human-derived PGAM5, expressed by E. coli , with C-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PGAM5 Protein, Human (His) is the recombinant human-derived PGAM5, expressed by E. coli , with C-6*His labeled tag. ,

Background

PGAM5 is a mitochondrial serine/threonine phosphatase that dephosphorylates various substrates, playing roles in processes like cellular senescence and mitophagy. It modulates mitochondrial dynamics by dephosphorylating DNM1L/DRP1 to promote fission and stress-sensitively dephosphorylating MFN2 to protect it from ubiquitination, aiding mitochondrial network formation. Independently of PARKIN, it regulates mitophagy by interacting with and dephosphorylating FUNDC1 (which binds LC3). PGAM5 also forms a tertiary complex with KEAP1 and NRF2 to regulate anti-oxidative responses, and acts as a RIPK3 target to recruit the RIPK1-RIPK3-MLKL necrosome to mitochondria, controlling necroptosis.

Verified Bioactivity

Human PGAM5 immobilized on CM5 Chip can bind LFHP-1c with an affinity constant of 425.8 nM as determined in a SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - SPR

    Bioactivity - SPR

    Human PGAM5 immobilized on CM5 Chip can bind LFHP-1c with an affinity constant of 425.8 nM as determined in a SPR assay.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Protein Length

    Mitochondrial intermembrane domain

  • Synonyms

    PGAM5; BXLBv68; PGAM Family Member 5, Mitochondrial Serine/Threonine Protein Phosphatase; PGAM Family Member 5, Serine/Threonine Protein Phosphatase, Mitochondrial; Phosphoglycerate Mutase Family Member 5; MGC5352; Serine/Threonine-Protein Phosphatase PGA

  • AA Sequence

    KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

  • Molecular Weight

    Approximately 31-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00