Pepinh-Control
Based on 1 Customer Validation
Pepinh-Control is a negative control peptide.
For research use only. We do not sell to patients.
- Purity: 99.04%
- Formula: C172H274N54O38S2
- Molecular Weight:3770.48
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Pepinh-Control (100 μM, 12 h) can be used as a Pepinh-MYD negative control to pre-incubate HDPFs (human dental pulp fibroblasts)[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3770.48
-
Formula C172H274N54O38S2
-
Color White to off-white
-
Sequence
Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Leu-His-Gly-Arg-Gly-Asp-Pro-Met-Glu-Ala-Phe-Ile-Ile-NH2
-
Sequence Shortening
RQIKIWFQNRRMKWKKSLHGRGDPMEAFII-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
DMSO : 25 mg/mL (6.63 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (278 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2652 mL | 1.3261 mL | 2.6522 mL | 6.6305 mL |
| 5 mM | 0.0530 mL | 0.2652 mL | 0.5304 mL | 1.3261 mL |