FCRL1 Protein, Human (HEK293, His)

Revisión del cliente

Based on 1 Customer Validation

The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: HEK293
  • Almacenamiento:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Help & FAQs

Actividad biológica

Descripciòn

The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The FCRL1 Protein takes on a potential role as an activating coreceptor in B-cells, suggesting its involvement in the intricate processes of B-cell activation and differentiation. This dual functionality positions FCRL1 as a key player in the modulation of B-cell responses, where it may act as a coreceptor to enhance signaling pathways associated with B-cell activation. The broader implication of FCRL1 in B-cell differentiation underscores its significance in orchestrating the nuanced cellular events that contribute to the adaptive immune response.

Verified Bioactivity

Immobilized FCRL1 at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG. The KD for this effect is 38.39 nM.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized FCRL1 at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG. The KD for this effect is 38.39 nM.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FCRL1 (A17-N303)
      Accession # Q96LA6-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FCRL1; Fc Receptor Homolog 1; Fc Receptor Like 1; FcR-Like Protein 1; FCRH1; HIFGP1; IRTA5; Immunoglobulin Superfamily Fc Receptor, Gp42; IFGP1; Fc Receptor-Like 1; CD307a; CD307a Antigen; Immune Receptor Translocation-Associated Protein 5; FcRH1; Fc Rece

  • AA Sequence

    AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSN

  • Predicted Molecular Mass

    32.6 kDa

  • Peso molecular

    Approximately 45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 1 mM EDTA.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00