Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide

Cat. No.: HY-P3616: Ficha de datos Instrucciones de manejo
FAQs
Technical Support

Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide Estructura química

Tamaño		Stock
MOQ		Minimum order quantity
50 mg		Obtener un presupuesto
100 mg		Obtener un presupuesto
250 mg		Obtener un presupuesto
Other size		Obtener un presupuesto

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Recomendaciones destacadas

•Related Small Molecules:

•Related Proteins:

Actividad biológica
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn	Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin^[1]^[2].
Peso molecular	3652.10
Fòrmula	C₁₆₅H₂₅₂N₄₄O₄₈S
Sequence Shortening	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Biotin-Lys}-NH2
Envío	Room temperature in continental US; may vary elsewhere.
Almacenamiento	Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación	Ficha de datos (258 KB) Instrucciones de manejo (2659 KB)
Referencias	[1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4. [Content Brief] [2]. Gutniak M, et al. Antidiabetogenic effect of glucagon-like peptide-1 (7-36)amide in normal subjects and patients with diabetes mellitus. N Engl J Med. 1992 May 14;326(20):1316-22. [Content Brief]