Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin.
For research use only. We do not sell to patients.
- Formula: C165H252N44O48S
- Molecular Weight:3652.10
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
Chemical Information
-
Molecular Weight 3652.10
-
Formula C165H252N44O48S
-
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Biotin-Lys}-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4. [Content Brief]
[2]. Gutniak M, et al. Antidiabetogenic effect of glucagon-like peptide-1 (7-36)amide in normal subjects and patients with diabetes mellitus. N Engl J Med. 1992 May 14;326(20):1316-22. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide Related Classifications
HY-P3616 Related Classifications
Powered by Bioz