VEGF164 Protein, Rat (sf9)

고객리뷰

Based on 1 Customer Validation

The VEGF164 protein is a growth factor critical for vasculogenesis, vasculogenesis, and endothelial cell growth, inducing proliferation, promoting migration, inhibiting apoptosis, and enhancing vascular permeability. It binds to FLT1/VEGFR1, KDR/VEGFR2, heparan sulfate, heparin, NRP1 and DEAR/FBXW7-AS1 receptors. VEGF164 Protein, Rat (sf9) is the recombinant rat-derived VEGF164 protein, expressed by Sf9 insect cells , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Rat
  • Source: Sf9 insect cells
  • 보관:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • References
  • Help & FAQs

Biological Activity

제품 설명

The VEGF164 protein is a growth factor critical for vasculogenesis, vasculogenesis, and endothelial cell growth, inducing proliferation, promoting migration, inhibiting apoptosis, and enhancing vascular permeability. It binds to FLT1/VEGFR1, KDR/VEGFR2, heparan sulfate, heparin, NRP1 and DEAR/FBXW7-AS1 receptors. VEGF164 Protein, Rat (sf9) is the recombinant rat-derived VEGF164 protein, expressed by Sf9 insect cells , with tag free.

Background

VEGF164, a growth factor with pivotal roles in angiogenesis, vasculogenesis, and endothelial cell growth, orchestrates a range of cellular responses crucial for vascular development. It stimulates endothelial cell proliferation, facilitates cell migration, prevents apoptosis, and enhances blood vessel permeability by binding to receptors such as FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. During lactation, VEGF164 may contribute to increased vascular permeability, supporting efficient transport of molecules for milk protein synthesis. Additionally, its interaction with the NRP1 receptor initiates signaling pathways essential for motor neuron axon guidance and cell migration, underscoring its involvement in embryonic development processes. Existing as a homodimer with disulfide linkage, VEGF164 also forms a heterodimer with PGF and interacts with isoform 2 of BSG, revealing its multifaceted molecular interactions.

Verified Bioactivity

Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC) and the ED50 is typically 1-10 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VEGF164 (A27-R190)
      Accession # P16612-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    19.2 kDa

  • 분자량

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 100 mM Glycine, 10 mM NaCl, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

견적 받기 해외재고보유

Other size
견적 받기
Please select quantity
Amount: USD 0.00