SPAI-1
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na+, K+-ATPase and H+, K+-ATPase in vitro, stimulates Mg2+-ATPase.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- CAS No.: 131359-77-8
- 화학식: C245H386N72O65S8
- 분자량:5628.57
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
제품 설명
In Vitro
SPAI-1 (10 nM; 2.5 hr) inhibits Na+, K+-ATPase by the competitive mode against Na+ and is uncompetitive with K+. The IC50 of Na+, K+-ATPase inhibition effect is 0.12 μM[1].
SPAI-1 (3-10 μM; 10 or 20 min) significantly inhibits Na+, K+-ATPase[2].
SPAI-1 (0.1-100 μM; 10 or 20 min) shows light difference between enzyme preparations from dog and rat. As isoforms of Na+, K+-ATPase obtained from rats, SPAI-1 shows inhibition with IC50s of 8.7-24.6 μM; as for isoforms of Na+, K+-ATPase obtained from dog, SPAI-1 shows inhibition with IC50s of 11.6-17.5 μM[2].
SPAI-1 (0.1-100 μM; 10 or 20 min) stimulates ouabain-insensitive Mg2+-ATPase at high concentration but failed to inhibit Ca2+-ATPase[2].
SPAI-1 (0.01-50 μM; 10 or 20 min) also inhibits H+, K+-ATPase with an IC50 value of 5 μM[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
Chemical Information
-
CAS No. 131359-77-8
-
분자량 5628.57
-
화학식 C245H386N72O65S8
-
Sequence Shortening
LLSKRGHCPRILFRCPLSNPSNKCWRDYDCPGVKKCCEGFCGKDCLYPK (Disulfide bridge:Cys8-Cys37,Cys15-Cys41,Cys24-Cys36,Cys30-Cys45)
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
순도&문서
References
[1]. Araki K, et al. Novel peptide inhibitor (SPAI) of Na+, K+-ATPase from porcine intestine. Biochem Biophys Res Commun. 1989 Oct 16;164(1):496-502. [Content Brief]
[2]. Ishizuka N, et al. Na+,K(+)-ATPase inhibition by an endogenous peptide, SPAI-1, isolated from porcine duodenum. Biochim Biophys Acta. 1991 Nov 4;1069(2):259-66. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)