Pandinotoxin Kα
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel.
For research use only. We do not sell to patients.
- CAS No.: 185529-64-0
- Formula: C169H267N53O48S7
- Molecular Weight:4033.71
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
|
Kv4.3 |
Kv3.4 |
Kv1.4 |
Chemical Information
-
CAS No. 185529-64-0
-
Molecular Weight 4033.71
-
Formula C169H267N53O48S7
-
Sequence
Thr-Ile-Ser-Cys-Thr-Asn-Pro-Lys-Gln-Cys-Tyr-Pro-His-Cys-Lys-Lys-Glu-Thr-Gly-Tyr-Pro-Asn-Ala-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Phe-Gly-Arg (Disulfide bridge: Cys4-Cys25,Cys10-Cys30,Cys14-Cys32)
-
Sequence Shortening
TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR (Disulfide bridge: Cys4-Cys25,Cys10-Cys30,Cys14-Cys32)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. T C Tenenholz, et al. Solution Structure for Pandinus Toxin K-α (PiTX-Kα), a Selective Blocker of A-Type Potassium Channels. Biochemistry. 1997 Mar 11;36(10):2763-71. [Content Brief]
[2]. Targeting Kai-Zheng Duan, et al. A-type K(+) channels in primary sensory neurons for bone cancer pain in a rat model. Pain.2012 Mar;153(3):562-574. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz