Copy Link Print Information

14-3-3 beta Protein, Cynomolgus

Customer Review

Based on 1 Customer Validation

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • 14-3-3 beta Protein, Cynomolgus Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Background

14-3-3 beta protein serves as an adapter involved in the regulation of diverse signaling pathways, engaging with numerous partners through recognition of phosphoserine or phosphothreonine motifs. The resulting interactions typically modulate the activity of the binding partner. Functioning as a negative regulator of osteogenesis, it impedes the nuclear translocation of the phosphorylated form of SRPK2, counteracting SRPK2's stimulatory effect on cyclin D1 expression and thereby preventing neuronal apoptosis. Additionally, 14-3-3 beta negatively regulates signaling cascades that activate MAP kinases via AKAP13. Existing as a homodimer, it interacts with various proteins, including SAMSN1, PRKCE, AKAP13, SSH1, TORC2/CRTC2, ABL1, ROR2, GAB2, YAP1, SRPK2, AANAT, MYO1C, SIRT2, DAPK2, PI4KB, TBC1D22A, TBC1D22B, SOS1, SLITRK1, SYNPO2, RIPOR2, MARK2, MARK3, TESK1, MEFV, HDAC4, and ADAM22, participating in diverse cellular processes.

Technical Parameters

  • Species Cynomolgus
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q4R572-2 (M1-N244)

  • Gene ID
    101926442  [NCBI]
  • Molecular Construction
    • N-term
    • 14-3-3β (M1-N244)
      Accession # Q4R572-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    YWHAB; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Beta; YWHAA; 14-3-3 Protein Beta/Alpha; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Alpha Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxyg

  • AA Sequence

    MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

  • Predicted Molecular Mass

    27.9 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 10% Glycerol, 0.5 mM DTT, pH 7.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 14-3-3 beta Protein, Cynomolgus Product Image
    1/16
  • 14-3-3 beta Protein, Cynomolgus Product Image