Copy Link Print Information

14-3-3 epsilon Protein, Human (GST)

Customer Review

Based on 1 Customer Validation

14-3-3 epsilon Protein, Human (GST) is a mediator that guides chondrocytes toward an inflammatory phenotype with GST tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for 14-3-3 epsilon Protein, Human (GST)
  • Experimental Validation Results for 14-3-3 epsilon Protein, Human (GST)
  • 14-3-3 epsilon Protein, Human (GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

14-3-3 epsilon Protein, Human (GST) is a mediator that guides chondrocytes toward an inflammatory phenotype with GST tag[1].

Background

14-3-3ε is able to induce an inflammatory phenotype in synoviocytes, macrophages and chondrocytes in addition to polarizing macrophages. 14-3-3ε acts as an alarmin in osteoarthritis (OA) and as a target either for therapeutic and/or prognostic purposes[1].

Verified Bioactivity

Immobilized Human 14-3-3 epsilon at 2μg/mL (100μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.3162 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human 14-3-3 epsilon at 2 μg/mL (100 μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.3162 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession

    P62258/NP_006752.1 (M1-Q255)

  • Gene ID
    7531  [NCBI]
  • Molecular Construction
    • N-term
    • GST
    • YWHAE (M1-Q255)
      Accession # P62258
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    YWHAE; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Epsilon; 14-3-3 Protein Epsilon; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Epsilon Polypeptide; 14-3-3 Epsilon; FLJ45465; 14-3-3E; Tyrosine 3/Tryptophan

  • AA Sequence

    MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

  • Predicted Molecular Mass

    56 kDa

  • Molecular Weight

    Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. M Millerand, et al. Activation of Innate Immunity by 14-3-3 ε, a New Potential Alarmin in Osteoarthritis. Osteoarthritis Cartilage. 2020 May;28(5):646-657. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human 14-3-3 epsilon at 2 μg/mL (100 μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.3162 μg/mL.

  • 14-3-3 epsilon Protein, Human (GST) Product Image
    1/16
  • Experimental Validation Results for 14-3-3 epsilon Protein, Human (GST)
  • Experimental Validation Results for 14-3-3 epsilon Protein, Human (GST)
  • 14-3-3 epsilon Protein, Human (GST) Product Image