1. Recombinant Proteins
  2. Others
  3. 14-3-3 epsilon Protein, Human (GST)

14-3-3 epsilon Protein, Human (GST) is a mediator that guides chondrocytes toward an inflammatory phenotype with GST tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

14-3-3 epsilon Protein, Human (GST) is a mediator that guides chondrocytes toward an inflammatory phenotype with GST tag[1].

Background

14-3-3ε is able to induce an inflammatory phenotype in synoviocytes, macrophages and chondrocytes in addition to polarizing macrophages. 14-3-3ε acts as an alarmin in osteoarthritis (OA) and as a target either for therapeutic and/or prognostic purposes[1].

Biological Activity

Immobilized Human 14-3-3 epsilon at 2μg/mL (100μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.3162 μg/mL.

  • Immobilized Human 14-3-3 epsilon at 2 μg/mL (100 μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.3162 μg/mL.
Species

Human

Source

E. coli

Tag

N-GST

Accession

P62258/NP_006752.1 (M1-Q255)

Gene ID
Molecular Construction
N-term
GST
YWHAE (M1-Q255)
Accession # P62258
C-term
Protein Length

Full Length

Synonyms
rHu14-3-3 protein epsilon, N-GST; YWHAE
AA Sequence

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Predicted Molecular Mass
56 kDa
Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

14-3-3 epsilon Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

14-3-3 epsilon Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
14-3-3 epsilon Protein, Human (GST)
Cat. No.:
HY-P7445
Quantity:
MCE Japan Authorized Agent: