1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. 4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His)

4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His)

Cat. No.: HY-P77574
Handling Instructions Technical Support

4-1BB/TNFRSF9 Protein, crucial with cytokine and protein binding, influences processes like interleukin regulation and cell proliferation.Located externally on the plasma membrane, its expression is notably high in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts.As the ortholog to human TNFRSF9, it suggests evolutionary conservation of functions across species.4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

4-1BB/TNFRSF9 Protein, crucial with cytokine and protein binding, influences processes like interleukin regulation and cell proliferation.Located externally on the plasma membrane, its expression is notably high in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts.As the ortholog to human TNFRSF9, it suggests evolutionary conservation of functions across species.4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag.

Background

4-1BB/TNFRSF9 Protein possesses crucial functions, including cytokine binding activity, identical protein binding activity, and signaling receptor activity. It acts upstream of or within various processes, such as negative regulation of interleukin-10 production, negative regulation of interleukin-12 production, and regulation of cell population proliferation. The protein is strategically located in the external side of the plasma membrane and extracellular space. It exhibits restricted expression, particularly prominent in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts. 4-1BB/TNFRSF9 is the orthologous counterpart to human TNFRSF9 (TNF receptor superfamily member 9), suggesting evolutionary conservation of its functions across species.

In Vitro

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation[4].

Species

Mouse

Source

HEK293

Tag

C-His

Accession

NP_001070976 (V24-L211)

Gene ID
Molecular Construction
N-term
4-1BB (V24-L211)
Accession # NP_001070976
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CD137; TNFRSF9; 4-1BB ligand receptor; 41BB; 4-1BB; CDw137; FLJ43501; ILA; T cell antigen ILA
AA Sequence

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL

Predicted Molecular Mass
21.2 kDa
Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His)
Cat. No.:
HY-P77574
Quantity:
MCE Japan Authorized Agent: