4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His)

4-1BB/TNFRSF9 Protein, crucial with cytokine and protein binding, influences processes like interleukin regulation and cell proliferation.Located externally on the plasma membrane, its expression is notably high in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts.As the ortholog to human TNFRSF9, it suggests evolutionary conservation of functions across species.4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag.

4-1BB/TNFRSF9 Protein possesses crucial functions, including cytokine binding activity, identical protein binding activity, and signaling receptor activity. It acts upstream of or within various processes, such as negative regulation of interleukin-10 production, negative regulation of interleukin-12 production, and regulation of cell population proliferation. The protein is strategically located in the external side of the plasma membrane and extracellular space. It exhibits restricted expression, particularly prominent in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts. 4-1BB/TNFRSF9 is the orthologous counterpart to human TNFRSF9 (TNF receptor superfamily member 9), suggesting evolutionary conservation of its functions across species.

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation^[4].

Mouse

HEK293

C-His

NP_001070976 (V24-L211)

21942  [NCBI]

Full Length of Mature Protein

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.