4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His)
4-1BB/TNFRSF9 Protein, crucial with cytokine and protein binding, influences processes like interleukin regulation and cell proliferation.Located externally on the plasma membrane, its expression is notably high in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts.As the ortholog to human TNFRSF9, it suggests evolutionary conservation of functions across species.4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
4-1BB/TNFRSF9 Protein, crucial with cytokine and protein binding, influences processes like interleukin regulation and cell proliferation.Located externally on the plasma membrane, its expression is notably high in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts.As the ortholog to human TNFRSF9, it suggests evolutionary conservation of functions across species.4-1BB/TNFRSF9 Protein, Mouse (isoform 2, HEK293, His) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag.
Background
4-1BB/TNFRSF9 Protein possesses crucial functions, including cytokine binding activity, identical protein binding activity, and signaling receptor activity. It acts upstream of or within various processes, such as negative regulation of interleukin-10 production, negative regulation of interleukin-12 production, and regulation of cell population proliferation. The protein is strategically located in the external side of the plasma membrane and extracellular space. It exhibits restricted expression, particularly prominent in the placenta adult (RPKM 139.4), emphasizing its significance in specific physiological contexts. 4-1BB/TNFRSF9 is the orthologous counterpart to human TNFRSF9 (TNF receptor superfamily member 9), suggesting evolutionary conservation of its functions across species.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q8R037/NP_001070976 (V24-L211)
-
Molecular Construction
-
N-term
-
4-1BB (V24-L211)
Accession # Q8R037/NP_001070976 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TNFRSF9; CDw137; Prev. ILA; Tumor Necrosis Factor Receptor Superfamily, Member 9; CD137; Induced By Lymphocyte Activation (ILA); 4-1BB; Homolog Of Mouse 4-1BB; Tumor Necrosis Factor Receptor Superfamily Member 9; Receptor Protein 4-1BB; T-Cell Antigen 4-1BB Homolog; T Cell Antigen ILA; 4-1BB Ligand Receptor; T-Cell Antigen ILA; CD137 Antigen; IMD109; TNF Receptor Superfamily Member 9; Interleukin-Activated Receptor, Homolog Of Mouse Ly63
-
AA Sequence
VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
-
Predicted Molecular Mass
21.2 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
