ADAM15 Protein, Human (CHO, His)
ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (CHO, His) is the recombinant human-derived ADAM15 protein, expressed by CHO , with C-His labeled tag.
- Species: Human
- Source: CHO
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (CHO, His) is the recombinant human-derived ADAM15 protein, expressed by CHO , with C-His labeled tag.
Background
ADAM15 protein is an active metalloproteinase that possesses gelatinolytic and collagenolytic activity. It is involved in various biological processes, including wound healing, heterotypic intraepithelial cell/T-cell interactions, and homotypic T-cell aggregation. ADAM15 also inhibits the adhesion and migration of airway smooth muscle cells mediated by beta-1 integrin. It suppresses cell motility towards fibronectin, potentially by reducing the expression of alpha-v/beta-1 integrin through the inactivation of ERK1/2. Additionally, ADAM15 cleaves E-cadherin in response to growth factor deprivation and plays a role in glomerular cell migration and pathological neovascularization. It may also have a role in cartilage remodeling. During sperm epididymal maturation and the acrosome reaction, ADAM15 may undergo proteolytic processing. Its disintegrin domain suggests a potential involvement in sperm-egg binding.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-His
-
Accession
Q13444 (D207-T696)
-
Molecular Construction
-
N-term
-
ADAM15 (D207-T696)
Accession # Q13444 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ADAM15; A Disintegrin And Metalloproteinase Domain 15 (Metargidin); ADAM Metallopeptidase Domain 15; Metalloprotease RGD Disintegrin Protein; MDC15; Metargidin; Metalloproteinase-Like, Disintegrin-Like, And Cysteine-Rich Protein 15; MDC-15; Disintegrin An
-
AA Sequence
DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT
-
Predicted Molecular Mass
54 kDa
-
Molecular Weight
Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
