1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. AGRP Protein, Human (HEK293, His)

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

Background

The AGRP protein plays a crucial role in weight homeostasis and is integral to the regulation of feeding behavior through the central melanocortin system. Functioning as an alpha melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production mediated by the stimulation of melanocortin receptors within the hypothalamus and adrenal gland. While exhibiting minimal activity with MC5R, AGRP serves as an inverse agonist for MC3R and MC4R, suppressing their constitutive activity. Moreover, AGRP promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner, underscoring its intricate involvement in modulating the activity of melanocortin receptors. The interaction of AGRP with MC3R, MC4R, and MC5R further highlights its regulatory role in the melanocortin signaling pathway, positioning it as a key player in the intricate balance of weight regulation and feeding control.

Biological Activity

Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically ≤0.1019 µg/mL, corresponding to a specific activity is ≥9813.543 U/mg, in the presence of 10 ng/mL of alpha-MSH(HY-P0252).

  • Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically 0.1019 µg/mL, corresponding to a specific activity is 9813.543 U/mg, in the presence of 10 ng/mL of alpha -MSH.
Species

Human

Source

HEK293

Tag

C-His

Accession

O00253 (A21-T132)

Gene ID

181  [NCBI]

Molecular Construction
N-term
AGRP (A21-T132)
Accession # O00253
His
C-term
Protein Length

Full Length of Mature Protein (with Propeptide)

Synonyms
Agouti-related protein; AGRP; AGRT; ART
AA Sequence

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

분자량

Approximately 16-21 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 5% trehalose, 5% mannitol, 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

AGRP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

AGRP Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
AGRP Protein, Human (HEK293, His)
Cat. No.:
HY-P75526
수량:
MCE Japan Authorized Agent: