AK3 Protein, Human (Myc, His)
AK3 Protein, Human (Myc, His) is a mitochondrial protein and is localized in the mitochondrial matrix.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AK3 Protein, Human (Myc, His) is a mitochondrial protein and is localized in the mitochondrial matrix.
Background
Adenylate kinase (hereinafter referred to as AK) catalyzes a reversible high-energy phosphoryl transfer reaction between adenine nucleotides. So far, six AK isozymes, AK1, AK2, AK3, AK4, AK5, and AK6, were identified. AK3 is expressed in all tissues except for red blood cells indicating that AK3 gene is a housekeeping-type gene. AK3 catalyzes 1 GDP or ADP molecule formation or the reverse reaction using GTP, not ATP, as a substrate for phosphate donation. This AK3 generates GDP and ADP using GTP produced by phosphorylation in the citric acid cycle at substrate level and AMP that exists in the matrix, respectively, and the generated GDP is utilizedin the next cycle of the citric acid cycle. while the ADP is utilized as a substrate of mitochondrial ATP synthetase[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;C-Myc
-
Accession
Q9UIJ7-1 (M1-P227)
-
Molecular Construction
-
N-term
-
10*His
-
AK3 (M1-P227)
Accession # Q9UIJ7-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
AK3; AKL3L; Prev. AK3L1; GTP:AMP Phosphotransferase, Mitochondrial; Prev. AK6; Adenylate Kinase 3 Like 1; GTP:AMP Phosphotransferase AK3, Mitochondrial; Adenylate Kinase 6; Adenylate Kinase 3 Alpha-Like 1; AK 3; AKL3L1; FIX; Adenylate Kinase Isozyme 3; Ad
-
AA Sequence
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
-
Predicted Molecular Mass
32.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
