1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators Biotinylated Proteins Kinases
  3. Receptor Tyrosine Kinases Transferases (EC 2) Serine/Threonine Kinase Proteins Protein Tyrosine Kinases TK
  4. ALK
  5. ALK Protein, Human (L1196M, Biotinylated, sf9, Avi)

ALK Protein, Human (L1196M, Biotinylated, sf9, Avi)

Cat. No.: HY-P702715
Handling Instructions Technical Support

ALK Protein, Human (L1196M, Biotinylated, sf9, Avi) is the recombinant human-derived ALK, expressed by Sf9 insect cells, with Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ALK Protein, Human (L1196M, Biotinylated, sf9, Avi) is the recombinant human-derived ALK, expressed by Sf9 insect cells, with Avi labeled tag.

Background

ALK is a neuronal receptor tyrosine kinase transiently expressed in specific nervous system regions, playing crucial roles in neurogenesis and differentiation. It also regulates energy homeostasis by controlling white adipose tissue lipolysis and sympathetic tone (By similarity). Activated by ALKAL2 (but not ALKAL1), it initiates intracellular signaling through MAPK pathway activation, phosphorylating targets like CBL, FRS2, IRS1, and SHC1. ALK may also be modulated by pleiotrophin (PTN) and midkine (MDK), which promote anti-apoptotic signaling and cell proliferation via MAPK/PI3K pathways. Additionally, ALK drives NF-κB activation through IRS1-AKT, essential for MDK-mediated autocrine growth and survival.

Species

Human

Source

Sf9 insect cells

Tag

N-Avi

Accession

Q9UM73 (V1058-P1620, L1196M)

Gene ID

238

Protein Length

Partial

Conjugation

Biotin

Synonyms
ALK; anaplastic lymphoma receptor tyrosine kinase; anaplastic lymphoma kinase (Ki 1); ALK tyrosine kinase receptor; CD246; CD246 antigen; mutant anaplastic lymphoma kinase; NBLST3;
AA Sequence

VYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ALK Protein, Human (L1196M, Biotinylated, sf9, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALK Protein, Human (L1196M, Biotinylated, sf9, Avi)
Cat. No.:
HY-P702715
Quantity:
MCE Japan Authorized Agent: