ALK Protein, Human (L1196M, Biotinylated, sf9, Avi)
Based on 1 Customer Validation
ALK Protein, Human (L1196M, Biotinylated, sf9, Avi) is the recombinant human-derived ALK, expressed by Sf9 insect cells, with Avi labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ALK Protein, Human (L1196M, Biotinylated, sf9, Avi) is the recombinant human-derived ALK, expressed by Sf9 insect cells, with Avi labeled tag.
Background
ALK is a neuronal receptor tyrosine kinase transiently expressed in specific nervous system regions, playing crucial roles in neurogenesis and differentiation. It also regulates energy homeostasis by controlling white adipose tissue lipolysis and sympathetic tone (By similarity). Activated by ALKAL2 (but not ALKAL1), it initiates intracellular signaling through MAPK pathway activation, phosphorylating targets like CBL, FRS2, IRS1, and SHC1. ALK may also be modulated by pleiotrophin (PTN) and midkine (MDK), which promote anti-apoptotic signaling and cell proliferation via MAPK/PI3K pathways. Additionally, ALK drives NF-κB activation through IRS1-AKT, essential for MDK-mediated autocrine growth and survival.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecencelabeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.39 nM, the conversion rate is about 40%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-Avi
-
Accession
Q9UM73 (V1058-P1620, L1196M)
-
Gene ID238
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
ALK; CD246 Antigen; ALK Receptor Tyrosine Kinase; Anaplastic Lymphoma Kinase (Ki-1); CD246; Mutant Anaplastic Lymphoma Kinase; ALK1; Tyrosine-Protein Kinase Receptor; Anaplastic Lymphoma Receptor Tyrosine Kinase; Uncharacterized Protein ALK; ALK Tyrosine
-
AA Sequence
VYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
-
Molecular Weight
Approximately 65 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 150 mM NaCl, 1 mM DTT, 10% glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
